KEGG   Gemmatimonas aurantiaca: GAU_1648Help
Entry
GAU_1648          CDS       T00878                                 

Gene name
manB
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GAU_1648 (manB)
   00030 Pentose phosphate pathway
    GAU_1648 (manB)
   00051 Fructose and mannose metabolism
    GAU_1648 (manB)
   00052 Galactose metabolism
    GAU_1648 (manB)
   00500 Starch and sucrose metabolism
    GAU_1648 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    GAU_1648 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    GAU_1648 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GAU_1648 (manB)
Enzymes [BR:gau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     GAU_1648 (manB)
    5.4.2.8  phosphomannomutase
     GAU_1648 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1968885..1970264)
Genome map
AA seq 459 aa AA seqDB search
MAISQTIFRQYDIRGIVGQDLTIEVAYGLGRGYAALLAQRGIQGAVAVGRDNRPTGDALR
DALVRGLTECGVDVVDVGVVPTPLLYWSLHHEPVVGGIQITGSHNPPEYNGFKMCLGTAS
LHGADIQTLYQLIIGGQFPSGSGQVRHVEVIDRYVADIVARIGPLTHADGTPIKVVYDCG
NGAGALVAPQLMEALGVQGIGLFTESDGSFPNHHPDPTVPENLEDCIAAVASSGAELGVA
FDGDADRIGVVDRNGRIIWGDHILILYARDVLARTGAGQPIIFDVKCSQALTDGISQAGG
TPVMWKTGHSLIKDKMKEMHAPIAGEMSGHMFFTEGFYGHDDALYAAARLLRIVADSGKR
VDELLADVPHFVSTPEIRIDTDDDTKFAIMAKAVPHFTASYDVIDVDGVRVLFGDGWGLL
RASNTQPVIVARYEARSEERLAEIRGVMEGWLREQGVTL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggccatcagtcaaacgatctttcggcagtacgacattcgcggcatcgtcggtcaggac
ctgaccatcgaagttgcgtatggactgggacggggatacgccgcgttgctcgcccaacgg
gggattcagggcgcggtggcggttggccgcgacaatcgcccgaccggcgatgccctgcga
gacgccctcgttcgtggcctcaccgaatgtggcgtggatgtggtggacgtgggggtggtt
cccaccccgctgctctactggtcgctgcaccacgaacccgtggtgggcggcatccagatc
accggttcacacaacccgcccgagtacaacggcttcaagatgtgcctcggtacggcgtcg
ctgcacggcgccgatatccagacactgtaccagttgatcatcggcgggcagttcccgtcg
ggcagcggccaggtgcggcacgtcgaagtcatcgaccgctacgttgccgacatcgtcgcc
cgcatcggcccgctcacccatgccgatggcacgcccatcaaggtcgtgtacgactgcggc
aacggcgccggtgcgctggtcgctccgcagctcatggaggcgctgggggtacagggcatc
ggcctgttcaccgagagtgacggctcgtttcccaatcaccatcccgatcctaccgtcccc
gagaatctcgaggactgcattgcggccgtggcctcatccggcgcggaactgggcgtcgcc
ttcgatggtgatgccgatcgcattggtgtggtggatcgcaacggtcgcatcatctggggc
gatcacatcctgatcctgtatgcacgcgacgtgctcgcgcgcaccggggcaggacagccg
atcatcttcgatgtgaagtgctcacaggcgctcaccgacggcatcagccaggccggtggc
acgccggtgatgtggaagaccggtcactccctcatcaaggacaagatgaaggagatgcat
gcgccgatcgcgggcgaaatgtcgggccacatgtttttcaccgaaggcttttacggacac
gatgacgccctgtatgcggcagcccggttgctgcgcatcgtggccgactccggcaagcgc
gtggacgaactgctcgccgatgtgccgcattttgtatcgacaccggaaatccgcatcgat
accgacgacgacaccaagttcgccatcatggcgaaggccgtgccgcacttcaccgcgtcc
tacgatgtgatcgatgtggacggggtgcgtgtgttgttcggcgatggatggggtctgctg
cgcgcctcgaatacgcagcccgtgatcgtggcgcggtacgaagcccgcagcgaagagcgc
ctggccgagattcgcggggtgatggaaggttggttgcgtgagcagggcgtcacgctgtga

DBGET integrated database retrieval system