KEGG   Gemmatimonas aurantiaca: GAU_1677Help
Entry
GAU_1677          CDS       T00878                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GAU_1677 (tpiA)
   01230 Biosynthesis of amino acids
    GAU_1677 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GAU_1677 (tpiA)
   00051 Fructose and mannose metabolism
    GAU_1677 (tpiA)
   00562 Inositol phosphate metabolism
    GAU_1677 (tpiA)
Enzymes [BR:gau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GAU_1677 (tpiA)
Exosome [BR:gau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GAU_1677 (tpiA)
  Exosomal proteins of bladder cancer cells
   GAU_1677 (tpiA)
  Exosomal proteins of melanoma cells
   GAU_1677 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1996975..1997730)
Genome map
AA seq 251 aa AA seqDB search
MHLKPVIAANWKLNHGPTDAKAFLQRFLAQVPKLNDRTVIFFPSAITLTTVTEGLRDRPE
IWVGVQNVHAEAQGAFTGENSVLMARDAGARVVLVGHSERRHVFGESDETTTKKMALIAQ
ARLTAMLCVGETLAEREAGHTADVVERQLAAGLKELDDQQIGAIMLAYEPVWAIGTGRTA
TPEDAAEIHGVLRRALASRVGDKVATGIPILYGGSVNRGNASQLLAASDVDGLLVGGASL
DADGWAGIVRA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcaagccggttattgcggccaactggaagctcaatcacggtccgacggacgcg
aaggcattcctgcagcggtttctcgcgcaggtgcccaagctcaacgaccgcacggtgatc
ttcttcccgtctgccatcacgctcaccacggtcacggaaggtctgcgcgaccgcccggag
atctgggtgggtgtgcagaacgtgcacgctgaagcgcagggtgcgttcacgggagaaaac
tcggtgctcatggcacgcgacgccggcgcccgggtggtgctcgtggggcactctgagcgt
cgccatgtgtttggtgaaagcgacgagacgaccacgaagaagatggcgctcatcgcccag
gcccggctcaccgccatgctgtgcgtcggggaaacgttggccgagcgcgaagccggacac
acggcggacgtcgtggagcggcagctcgccgctggcctcaaggagctcgacgaccagcag
attggcgccatcatgctggcctacgaaccggtgtgggccatcggaacgggccgtacggcc
acgccggaagacgcggccgagattcacggggtgctgcgccgggcgctggcatcgcgcgtg
ggcgacaaggtggcgactggcatcccgatcctgtatggcggctcggtgaaccgcgggaat
gcgtcgcagttgctggccgcgtcggatgtggacggcctgctggtcgggggcgcgtcgctg
gacgccgacggctgggcggggatcgtacgggcgtaa

DBGET integrated database retrieval system