KEGG   Gemmatimonas aurantiaca: GAU_1720Help
Entry
GAU_1720          CDS       T00878                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00260  Glycine, serine and threonine metabolism
gau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gau01100  Metabolic pathways
gau01110  Biosynthesis of secondary metabolites
gau01130  Biosynthesis of antibiotics
gau01230  Biosynthesis of amino acids
Module
gau_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GAU_1720 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GAU_1720 (trpA)
Enzymes [BR:gau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GAU_1720 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA FMN_dh His_biosynth ThiG NanE DUF3693
Motif
Other DBs
NCBI-ProteinID: BAH38762
NITE: GAU_1720
UniProt: C1A952
Position
complement(2040593..2041408)
Genome map
AA seq 271 aa AA seqDB search
MASASATTSPDVSAPSRLTARFRALAAEGRKALVCYVTAGYPDPASSVQLLRGLAEAGAD
VIEVGVPFSDPMADGPVIQHSSQVALEHGITLSRTLDIVKEAGLDVPVVLFSYLNPILAG
GDDVLRRARAAGVDGVLATDLPVGADPEREAWFGSSGLDFVRLVAPTTPAPRMAEIARHG
GGFVYLISRLGVTGERDSLPDDLPVTVQRLRSATSLPLCIGFGISTPADAKAAAALGDGV
VVGSALVRAAGRSIEDAIALTRSLRAALDER
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagcatcggcgaccacttcgcctgacgtctccgctccgtcgcgcctcactgcg
cggtttcgcgcactggccgccgaaggtcgaaaggcactcgtctgctatgtcacggccggt
tatccggacccggcctccagtgtgcaattgctgcgtgggctggccgaagcgggagcggat
gtcatcgaggtgggcgtcccgttctccgatccgatggccgatggtccggtcattcagcac
agctcacaggtcgcgctcgaacacggtatcacgctgtcccgcacgctcgacatcgtgaag
gaagcgggcctcgatgtgcccgtggtgttgttcagctacctgaatcccatcctggccggt
ggggacgatgtgttgcgtcgcgcccgcgcggcgggggttgatggtgtgctggctaccgac
ctgccggttggtgccgaccccgagcgcgaagcctggttcggatcgagcggtctcgatttt
gtgcgtctggtcgcgccgaccaccccggcgccgcgcatggcggagatcgcccggcacggc
gggggctttgtgtatctcatcagccgactcggcgtgaccggtgagcgtgactcgctccct
gacgatctcccggtcaccgtgcagcgtctacgcagcgccacctcgctgccactgtgcatc
ggttttggcatttccacgcctgctgatgccaaggccgctgccgccctgggtgatggcgtg
gtggtgggaagtgcgctggtgcgtgcggccggccgctccatcgaagatgccatcgcgctg
acgcgttcgctgcgcgcggccctcgatgagcgctga

DBGET integrated database retrieval system