KEGG   Gemmatimonas aurantiaca: GAU_1720Help
Entry
GAU_1720          CDS       T00878                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GAU_1720 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GAU_1720 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GAU_1720 (trpA)
Enzymes [BR:gau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GAU_1720 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(2040593..2041408)
Genome map
AA seq 271 aa AA seqDB search
MASASATTSPDVSAPSRLTARFRALAAEGRKALVCYVTAGYPDPASSVQLLRGLAEAGAD
VIEVGVPFSDPMADGPVIQHSSQVALEHGITLSRTLDIVKEAGLDVPVVLFSYLNPILAG
GDDVLRRARAAGVDGVLATDLPVGADPEREAWFGSSGLDFVRLVAPTTPAPRMAEIARHG
GGFVYLISRLGVTGERDSLPDDLPVTVQRLRSATSLPLCIGFGISTPADAKAAAALGDGV
VVGSALVRAAGRSIEDAIALTRSLRAALDER
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagcatcggcgaccacttcgcctgacgtctccgctccgtcgcgcctcactgcg
cggtttcgcgcactggccgccgaaggtcgaaaggcactcgtctgctatgtcacggccggt
tatccggacccggcctccagtgtgcaattgctgcgtgggctggccgaagcgggagcggat
gtcatcgaggtgggcgtcccgttctccgatccgatggccgatggtccggtcattcagcac
agctcacaggtcgcgctcgaacacggtatcacgctgtcccgcacgctcgacatcgtgaag
gaagcgggcctcgatgtgcccgtggtgttgttcagctacctgaatcccatcctggccggt
ggggacgatgtgttgcgtcgcgcccgcgcggcgggggttgatggtgtgctggctaccgac
ctgccggttggtgccgaccccgagcgcgaagcctggttcggatcgagcggtctcgatttt
gtgcgtctggtcgcgccgaccaccccggcgccgcgcatggcggagatcgcccggcacggc
gggggctttgtgtatctcatcagccgactcggcgtgaccggtgagcgtgactcgctccct
gacgatctcccggtcaccgtgcagcgtctacgcagcgccacctcgctgccactgtgcatc
ggttttggcatttccacgcctgctgatgccaaggccgctgccgccctgggtgatggcgtg
gtggtgggaagtgcgctggtgcgtgcggccggccgctccatcgaagatgccatcgcgctg
acgcgttcgctgcgcgcggccctcgatgagcgctga

DBGET integrated database retrieval system