KEGG   Gemmatimonas aurantiaca: GAU_1725Help
Entry
GAU_1725          CDS       T00878                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gau01100  Metabolic pathways
gau01110  Biosynthesis of secondary metabolites
gau01130  Biosynthesis of antibiotics
gau01230  Biosynthesis of amino acids
Module
gau_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GAU_1725 (trpC)
Enzymes [BR:gau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GAU_1725 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG OMPdecase QRPTase_C
Motif
Other DBs
NCBI-ProteinID: BAH38767
NITE: GAU_1725
UniProt: C1A3U2
Position
complement(2046462..2047307)
Genome map
AA seq 281 aa AA seqDB search
MQGFSSKTPETPVWTEPEGTLGQLTREAHARAMAVADRLEALKAVARDARPVVPFHQALT
GPHLRVIAEVKRASPSKGTIAPGLDAVGQAEAYVRGGAAAISVLTEPTRFGGSLEDLQAV
AAAVQVPVIRKDFLVHPVQLWEARAAGASAALLIVRSLAPSLLPLLIDTAREIGLEPLVE
IRDLVELERALAAGASVIGVNNRNLESLVIDTATAPAIIPHIPSDRVAVAESGMQQPDDL
HAPRDAGADAVLVGSAVSTATDPEAQVRALAAIARHATARR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaggattttcttcaaagacgcccgaaacacccgtctggaccgaacctgaaggcacc
ctcggacagctcacccgcgaggcacacgcccgggcgatggcggtcgccgaccgcctcgaa
gccctgaaggcggtggcgcgggacgcccgacccgtcgtgcctttccaccaggccctcacg
gggccacatctccgggtcatcgcggaggtgaagcgcgcgtcgccgtccaagggcacgatc
gcccccggactggacgccgtgggccaggccgaggcgtacgtgcggggcggggcagcggcg
atttcggtactgaccgaaccaacgcggtttggtgggtccctcgaagatctccaagcggtc
gctgctgccgtgcaggtgcccgtgatccgcaaggacttcctcgtgcaccccgtccagttg
tgggaggctcgcgcggccggtgcttcggcggcgctgttgatcgtacgatcactggccccc
tcgctgctgccactgctgatcgacacggcacgcgagatcggactcgaaccactggtggag
attcgcgatctcgtcgaactcgaacgggcgctggccgctggcgcttcggtcatcggtgtc
aacaatcgcaatctcgaatcactggtcatcgatacggccacggcgccggccatcattccg
cacatcccctccgatcgggtggccgtggcggagagtggcatgcagcagccggacgatctg
cacgcgccccgcgatgccggcgccgatgccgtactggttggcagcgcggtctctacggca
accgatccggaagcccaggtgcgtgcgttggccgcgattgcccgtcatgccaccgcccgt
cgctga

DBGET integrated database retrieval system