KEGG   Gemmatimonas aurantiaca: GAU_1747Help
Entry
GAU_1747          CDS       T00878                                 

Gene name
coaA
Definition
pantothenate kinase (EC:2.7.1.33)
Orthology
K00867  
type I pantothenate kinase [EC:2.7.1.33]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Class
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:gau00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2071577..2072554)
Genome map
AA seq 325 aa AA seqDB search
MLDVMPQGTSGAPASSLPRLAPPYVIFDREHWATLRAETPLALSEAELLALAGVNDPTSL
SDVTEVFLPLVRLIELHMAAARSLRHMVDGAFVGQWRATAPYVIAIAGSVAVGKSTFARL
LRAVLGQSQNRPRVELVTTDGFLQPTQVLQANGLMERKGFPESYDLRKMLAFLEGLKSGE
SQLRIPTYSHEAYDVVPGEFQVVDRPDILIFEGLNVLQTANSLVAVASDFFDFTIYLDAD
TATIEEWYVDRFLKLQRTVFQREASYFHHYKDLTPEAAAKVARDIWRRINLPNLEENIEP
TRRRARVVMRKGSDHRVEEIWLRQT
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgtgatgccgcagggcacctccggcgcgccggcgtcttcactgccgcgtctg
gcgccgccgtatgtgattttcgaccgcgagcattgggcgaccctgcgcgccgagaccccg
ttggcgctgtcggaagccgaactgctggcgctggctggcgtgaacgatcccacgtcactc
agcgacgtgaccgaggtattcctgcctctggtgcgcttgattgagctccacatggccgcc
gcccgcagcctgcgtcacatggtggacggggcgtttgtgggacaatggcgcgccacggcg
ccgtacgtgatcgccattgccggcagtgtggccgtgggcaaaagcaccttcgcacgcctc
ctgcgagcagtgctgggccaaagccagaatcgtcctcgcgtcgagctcgttaccacggat
ggctttctccagccgacccaggtgctgcaggcgaatgggctcatggagcgcaaagggttt
ccggaaagctatgatctgcgaaagatgctggcctttctggaggggttgaagtcgggcgaa
tcgcaactgcggattcccacttactcgcatgaagcctacgacgtggtgcccggggaattt
caggtcgtcgaccgtccggacatcctgatcttcgaaggcctgaatgtcctgcagacggcg
aacagtctggtggcggtggcttcggacttttttgacttcacgatttatctggatgccgat
accgcgacgatcgaggagtggtatgtcgatcgcttcctgaagctgcagcgcacggtgttc
caacgcgaagcctcctacttccatcactacaaagacctgacaccagaggccgcggccaag
gtggcccgcgatatctggcgtcggatcaaccttccgaatctggaagagaatatcgagccg
acacgccgacgcgcccgtgtggtgatgcgaaaggggagtgatcaccgggtcgaggagatc
tggctacgccagacctga

DBGET integrated database retrieval system