KEGG   Gemmatimonas aurantiaca: GAU_1993Help
Entry
GAU_1993          CDS       T00878                                 

Definition
dihydrolipoamide acyltransferase (EC:2.3.1.-)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GAU_1993
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GAU_1993
  Amino acid metabolism
   00310 Lysine degradation
    GAU_1993
Enzymes [BR:gau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GAU_1993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2323395..2324717)
Genome map
AA seq 440 aa AA seqDB search
MARVDVIMPQMGESIAEGTVSRWLKKVGDSVKRDEPIFEISTDKVDAEIPSPSAGVLMEI
LVGDGLTVAVNTVVARLETDAAAAAAAPAPSAPAPAAVVAAPAAAPVAATSAPAPAAPKA
PAAPSGSFEERVRTKSSPLVRKIAAEQGVEIGALTGSGIAGRVTRKDLDAYLTSRPAGSA
APAAAPVSVSHAPSDSHGPAATPWAGDIVEPMSKIRKLTSEHMSLARRVAAHVTTLWEVD
LTRVARVRAAVRKDFEAQSGQKLTYLPFILQAVCQQLKRHPMINTAVSGENLIYRKQINL
GIAVALEPTGLIVPVLKHADELSLTGLTRGVNDLAGRARSKKLSPTDVQDATFTISNPGT
FGSLTGTPIIPVGTTAILCLGAIEKRPKVITGADGEDTIAIRTCAYFSLSFDHKVIDGAD
ADRFMGDIKKALESVTEAVV
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtggctcgtgtagacgtaatcatgccgcagatgggcgagtccatcgcggagggcaccgta
tcacgctggctcaagaaggtgggcgacagcgtgaagcgtgatgaaccgatcttcgaaatc
tccaccgacaaggtcgacgcggagattccgtctccgtcggctggtgtgctgatggagatc
ttggttggtgacgggctcaccgtggccgtgaacacggtcgtggcccgcttggagaccgat
gcggccgctgcggcggcggcgcctgctcccagtgccccagctccggcggcggttgtggcc
gcaccggctgcggcgcctgtcgccgccaccagcgcgcccgcgccggcggccccgaaggcg
ccggccgcgccgtccgggtcgttcgaagaacgcgtgcgcaccaagtcgtcgccgctcgtg
cggaaaatcgctgccgaacagggcgtggagatcggcgccttgaccggcagtggtatcgcc
ggccgggtcacccgcaaggatctcgacgcctatctcacgtcgcgtccggctggtagtgcg
gctcccgccgcggcgccggtatcggtgtcgcatgcgccgtccgactcgcatggccctgcg
gccacgccgtgggccggtgacatcgtcgaaccgatgtccaagatccgcaagctcacctcg
gagcacatgtcgctggcccgtcgggtggcggcgcacgtgaccacgctgtgggaagtggat
ctgacgcgtgtggcgcgggtgcgtgctgcggtgcgcaaggacttcgaagcccagtctggc
cagaagctcacctacctgccgttcatcctgcaggcggtctgtcagcagctcaagcgccac
ccgatgatcaacaccgcggtgtcgggcgaaaacctgatctaccgcaagcagatcaacctt
ggcatcgccgttgcactcgagcccacgggcctcatcgtgccagtgctcaagcacgccgat
gaactctcgctgaccggcctcacgcgtggtgtgaacgatctcgccggccgtgcgcgcagc
aagaagctgagcccgaccgacgtgcaggacgccacgttcaccatcagcaaccccggcacg
ttcggctcgctgacgggcacgccgatcattccggttggtaccacggcgatcctctgcctc
ggtgccatcgagaagcgccccaaggtcatcacgggcgcggacggcgaagacacgattgcc
atccgcacctgcgcctatttctcgctatccttcgatcacaaggtcatcgacggcgcggat
gcggatcgtttcatgggcgatatcaagaaggccctcgaatcggtcaccgaagcggtcgtc
tga

DBGET integrated database retrieval system