KEGG   Gemmatimonas aurantiaca: GAU_2112Help
Entry
GAU_2112          CDS       T00878                                 

Definition
putative acyl-CoA thioesterase (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    GAU_2112
Enzymes [BR:gau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     GAU_2112
   3.1.2  Thioester hydrolases
    3.1.2.-  
     GAU_2112
Lipid biosynthesis proteins [BR:gau01004]
 Fatty acid synthase
  Component type
   GAU_2112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2471493..2472164)
Genome map
AA seq 223 aa AA seqDB search
MAENTPEGTDGAASSSAGGARRVQRVVFLGTSLTAGLGLDPEKAYPALLQAKADSAGYAV
RIVNAGLSGETSAGALRRAGWVLDQPAAMVVLEVGANDGLRGVDPDSTYANLVKLVAAVR
AGQPGVSLALVQMEAPTNLGRSYTTRFHTAYERAARETGIPLWPFLLDGVAGDATLNQAD
GIHPNVVGSQRVAETVWRSLGPALAALQAAPSGMPSGTPPATP
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtggcggagaatacacccgagggcacagatggcgccgcttcgtcttcggcgggcggtgcg
cggcgtgtgcagcgggtggttttcctgggcaccagcctcacggccggtctgggactcgat
cccgaaaaggcgtatcccgcactgctgcaggccaaggccgattcggccgggtatgcggtg
cggatcgtgaacgccggcttgagcggtgagacctcggccggggcgctgcgtcgggcgggg
tgggtgttggaccaacccgccgccatggtggtcctggaagtgggggccaatgacgggctg
cgcggcgtggatcccgattccacctatgccaatctggtgaagctggtggcggccgtgcgg
gccggtcagccgggtgtgtcgctggctttggtccagatggaggctcccacgaatctcgga
cggagctacacgacgcgctttcataccgcctacgaaagagcggcccgtgagacgggcatc
ccgctctggcccttcctgctggacggggtggcgggtgacgcgacgttgaatcaggctgat
ggcattcaccccaacgtggtgggctcccagcgtgtggccgagaccgtgtggcggtcactg
ggaccggccttggcggcactccaggccgcgccgtctggtatgccgtctggtacgccgccc
gcgacaccctga

DBGET integrated database retrieval system