KEGG   Gemmatimonas aurantiaca: GAU_2112Help
Entry
GAU_2112          CDS       T00878                                 

Definition
putative acyl-CoA thioesterase (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:gau01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2471493..2472164)
Genome map
AA seq 223 aa AA seqDB search
MAENTPEGTDGAASSSAGGARRVQRVVFLGTSLTAGLGLDPEKAYPALLQAKADSAGYAV
RIVNAGLSGETSAGALRRAGWVLDQPAAMVVLEVGANDGLRGVDPDSTYANLVKLVAAVR
AGQPGVSLALVQMEAPTNLGRSYTTRFHTAYERAARETGIPLWPFLLDGVAGDATLNQAD
GIHPNVVGSQRVAETVWRSLGPALAALQAAPSGMPSGTPPATP
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtggcggagaatacacccgagggcacagatggcgccgcttcgtcttcggcgggcggtgcg
cggcgtgtgcagcgggtggttttcctgggcaccagcctcacggccggtctgggactcgat
cccgaaaaggcgtatcccgcactgctgcaggccaaggccgattcggccgggtatgcggtg
cggatcgtgaacgccggcttgagcggtgagacctcggccggggcgctgcgtcgggcgggg
tgggtgttggaccaacccgccgccatggtggtcctggaagtgggggccaatgacgggctg
cgcggcgtggatcccgattccacctatgccaatctggtgaagctggtggcggccgtgcgg
gccggtcagccgggtgtgtcgctggctttggtccagatggaggctcccacgaatctcgga
cggagctacacgacgcgctttcataccgcctacgaaagagcggcccgtgagacgggcatc
ccgctctggcccttcctgctggacggggtggcgggtgacgcgacgttgaatcaggctgat
ggcattcaccccaacgtggtgggctcccagcgtgtggccgagaccgtgtggcggtcactg
ggaccggccttggcggcactccaggccgcgccgtctggtatgccgtctggtacgccgccc
gcgacaccctga

DBGET integrated database retrieval system