KEGG   Gemmatimonas aurantiaca: GAU_2434Help
Entry
GAU_2434          CDS       T00878                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase/AP lyase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:gau03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2854777..2855616
Genome map
AA seq 279 aa AA seqDB search
MPELPETETIARDLHAMVVGSVVRDVSVPRPDVLREIAAADLCSALSGGRITRVWRRAKL
IVLDLTLADRQNSHLVVQPRFTGGLLVDDGTLPTSEFAYSCVAMSLGDGRTLHYRDVRRL
GTVALMPEARFLEYSSGLGPEPLDQTFDATAFSGCVRLSHQSIKVVLMDQRRLAGVGNIY
ANEALWRAGIDPSREASSLTFAEAERLHTALRDVLTASIAARGTSFRDYRDARGERGTFV
EQLAAYGRGGEPCPRCGRRLVVTHAVDGRSTVFCPGCQF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgaactgccggaaacggagaccatcgcgcgcgatctgcacgcgatggtggtgggc
agcgtggtgcgggatgtttcggtgccccgccccgatgtgctgcgtgagattgccgcagcg
gatttgtgcagcgccttgtctggtgggcgcatcacccgggtgtggcgccgcgccaagctg
atcgtgctcgacctcacgctggccgataggcagaacagccacctcgtggtgcagccgcgc
ttcactggtgggctgctggtggacgacggcacgttgccgaccagcgagtttgcctacagt
tgtgtggcgatgtctctcggcgatggtcgcaccctccactatcgcgacgtgcgccggctg
ggcacggtggcgctgatgccagaggcgcgatttctcgaatattcgtcggggctgggcccc
gagccccttgaccaaacattcgacgcaactgcattttcgggttgtgttcggttatcgcat
cagtccatcaaagtcgttttgatggatcagcggcgattggccggcgttggcaacatctac
gcgaacgaggccctgtggcgcgccggcatcgatccttcccgagaagcttcctcgttgacg
tttgccgaggcagaacggctgcacaccgcgttgcgcgacgtgctgacggcgagcatcgcg
gcccgtggcaccagtttccgcgactatcgggatgcgcgaggtgagcgtggcaccttcgtt
gagcaactggccgcctacggacgcggcggggaaccctgccctcgctgcggtcgacggctc
gtggtcacccacgccgtggacggccgcagcacggtcttctgcccgggctgccagttctag

DBGET integrated database retrieval system