KEGG   Gemmatimonas aurantiaca: GAU_2593Help
Entry
GAU_2593          CDS       T00878                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GAU_2593 (hemB)
Enzymes [BR:gau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     GAU_2593 (hemB)
Exosome [BR:gau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GAU_2593 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3044855..3045832)
Genome map
AA seq 325 aa AA seqDB search
MMSAVRMRRLRGSEAMRRLVRETRLHPSQFIWPLFVRSGTGVRTPIGSMPGVSQTSVDEL
LRDAERAMTAGLGGILLFGIPDTKDAVGSSAWDPHGPVPEAVRAVKREFPDLLVITDVCM
CEYTDHGHCGLLTPSGDVDNDATLALLAKEALAHAEAGADIVAPSDMMDHRVAYLRQALD
GAGYTHLPIMSYAAKYASAFYGPFREAAESTPAFGDRRSYQMDSANGREALREVRLDVEE
GADILMVKPAGAYLDIISAVKRDTRMPLAAYQVSGEYSMIRAAAERGWIDGDRAMMESLV
AIARAGADMIITYFALDAAAHLARR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgatgtctgccgtgcgcatgcgtcgtctgcgtggcagcgaagccatgcggcgcctggtg
cgtgagacgcgcttgcatccgtcgcagttcatctggccgttgtttgtgcggtcaggcacc
ggcgtgcgcacgccgatcggttccatgcccggcgtgtcgcaaacgtccgtggatgaattg
ttgcgcgacgccgagcgtgcgatgaccgccggtctcggtggcatcctgttgttcggcatt
ccagacacgaaggatgccgttggtagttcggcgtgggatccgcatggtccggtacccgaa
gcggtgcgcgcggtgaaacgcgagtttccggacctgttggtgattaccgacgtgtgcatg
tgcgaatacaccgatcacgggcactgtggactgctcacccccagtggcgacgtggacaac
gacgccacgttggcgttgctggcgaaggaagcgttggcccatgccgaggcgggcgcggac
atcgtggccccgagcgacatgatggatcatcgggtggcgtacctgcgccaggcgttggat
ggtgcggggtatacccatctgcccatcatgagttatgccgccaagtatgcgtctgcgttt
tacgggccattccgcgaggcggccgaaagcacgccggcctttggcgaccgccgtagctat
cagatggattcagccaacgggcgcgaagccctgcgggaggtccggctcgacgtggaagag
ggtgccgacatcctgatggtgaagccggccggcgcctatcttgatatcatctcggccgtg
aaacgtgacacccgcatgccgttggctgcctatcaggtcagcggtgagtattcgatgatc
agagccgccgccgaacggggctggatcgacggggatcgggcgatgatggaatcgctggtc
gccattgcccgggccggcgcggacatgatcatcacctattttgccctcgacgccgctgcg
catcttgcgcggcgctga

DBGET integrated database retrieval system