KEGG   Gemmatimonas aurantiaca: GAU_2595Help
Entry
GAU_2595          CDS       T00878                                 

Gene name
hemD
Definition
putative uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gau00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3046833..3047612)
Genome map
AA seq 259 aa AA seqDB search
MGSLLAGVRIAVTRTVERGGPLADALRRVGATVHEIPLTHIEPLDAAPLHAALRELAHYD
WVLLTSVNAVERLAQAVREVGAESVMESRRLAVVGSTTAAACESHGWRLPTVQPERMQAE
GVLDDLASRSDVEGSRVLYPAAAGARDVLPEGLRALGAVVDVIATYRTVPDAAGQERMLA
LVESGEVDLVTLAAPSAMDALLDALPPERASRLPVACIGPVTARAARLAGFPVKVESTAP
TVEGWVRSIVQAYASRSTG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgggctcgctgctggctggtgtgcgcattgccgtgacacgcacggtcgaacggggcggc
ccgctggccgatgcgttgcgacgagtgggggccacggtgcatgagattcctctcacccat
atcgagccactcgatgcggcgcccttgcatgccgcgctgcgtgaactggcgcactacgac
tgggtgctgctcaccagcgtgaatgccgtggaacgactggcgcaggccgtgcgggaggtc
ggtgcggagtcggtgatggaatcgcgtcgtctggcggtggtgggcagtaccacggccgcc
gcgtgtgaatcgcatggctggcgattacccacggtgcagcccgagcgcatgcaggccgag
ggggtgctggatgacttggcgtcgcgttcggatgtggaaggctcccgggtgctgtatccc
gctgcggctggtgcgcgcgatgtgctgcccgaggggctgcgcgcgctcggtgccgttgtg
gatgtgatcgcgacctatcgcaccgtaccggacgctgcggggcaggagcgtatgctggcg
ctggtggagtctggcgaagtggacctggtcacgctggccgcacccagtgcgatggatgcc
ctgctggacgccttgccgcccgaacgggccagccggttgcctgtggcgtgcattggtccg
gtgacggcacgcgcggcgcgcctggcgggctttccggtgaaggtggaaagcaccgcgccc
acggtggaaggctgggtgcgcagcatcgtgcaggcgtacgcgtcgcgatcgacgggatga

DBGET integrated database retrieval system