KEGG   Gemmatimonas aurantiaca: GAU_2600Help
Entry
GAU_2600          CDS       T00878                                 

Gene name
acs
Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gau01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gau00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gau00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gau00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:gau00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3050283..3052247
Genome map
AA seq 654 aa AA seqDB search
MSDIDVLLQETRTFPPSEEFRAGAWVRDNALREAAAADPVGFWAKESEALDWMTPWSTAL
EWEPPRAKWFQGGTLNASVNCIDRHVHGPRRNKAALIWEGEPGDRRTFTYWDLYREVNLA
ANMLKKLGVGRGDRVAIYLPMIPEAVIAMLACARIGAIHTVVFGGFAPESLRDRINDCGC
KLLITADGGSRRGQMVPLKRNADVALKECPSIENVLVVMRRRSGVGDETFAEMQEGRDHW
WHRLKRQVPRYCEPEAMDAEDVLFVLYTSGTTGKPKGIVHTTGGFLTGVATTTKYTFDLK
EEDVYWCTADIGWITGHSYLVYGPLANGATCVMYEGAPDWPDKDRFWQICERYGVTILYT
APTAIRAFMKWGTEYVKKHDLSQLRVLGSVGEPINPEAWMWYHEHIGDFQCPIVDTWWQT
ETGAIMITPLPGVTTTKPGSATVPFPGIRTALLDANANELTVGGGLLAITHPWPSMLRTI
WGDDQRYVDTYFSKWPGRPDLYFPGDGAKLDEDGYLWILGRVDDVLNVSGHRIGTMEVES
ALVDHPSVAEAAVVGKHHDLKGQAIAAFVTLRAGFTASGSLRDELRDHVAQKIGALARPD
DILFSADLPKTRSGKIMRRLLRDIAEGRALGDTTTLADPSVVASLKDQYEAQES
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcgacgtcctgttgcaggaaacacgcacgtttccgccttccgaagaattc
cgcgccggtgcctgggtgcgtgacaacgccctgcgcgaggcggcggcggccgacccggtc
ggcttctgggccaaagaatcggaagccctcgattggatgaccccgtggtccacggcactc
gagtgggagccgccgcgcgccaagtggttccagggtggcacgctgaacgcctcggtgaac
tgcatcgaccgccatgtgcatggcccgcgccgcaacaaggcggcactgatctgggaaggc
gaaccgggtgatcgtcggacgttcacctattgggatctgtatcgcgaagtgaatctcgcg
gccaacatgctcaagaagctgggtgtgggtcgtggtgatcgtgtggccatttacctgccc
atgatccctgaggcggtgatcgcgatgctggcctgcgcgcgcatcggtgccattcacacc
gtcgtgtttggtggcttcgcgcccgagtcattgcgtgaccggatcaacgattgtggctgc
aagttgctcatcaccgccgatggtggttctcgccgcgggcagatggtgccgctcaagcgc
aatgccgacgtcgcgctcaaggaatgccccagcatcgaaaacgtgctcgtggtgatgcgg
cggcgcagtggcgtgggtgacgaaaccttcgccgagatgcaggaaggccgcgatcactgg
tggcatcgtctcaagcgccaggtgccgcgctattgcgagcccgaagccatggacgccgag
gacgtgctgttcgtgctgtacacgtccggcaccaccggcaagcccaagggcatcgtgcac
accaccggtggatttctcaccggcgtcgccaccaccaccaagtacaccttcgatctcaag
gaagaagacgtgtactggtgcacagccgacatcggctggatcaccggccactcgtatctc
gtgtacggcccgttggccaatggtgcgacgtgcgtgatgtacgaaggtgcgcccgactgg
cccgacaaggaccggttctggcagatctgcgagcgctatggcgtcacgattctgtacacg
gcgcccaccgccattcgggcgttcatgaagtggggcacggagtacgtcaaaaagcacgat
ctctcgcaactgcgtgtgctcggttcggtgggggagcccatcaatcccgaagcctggatg
tggtatcacgagcatatcggcgactttcagtgccctattgtcgatacatggtggcagacg
gaaaccggtgccatcatgatcacaccactccccggggtcaccaccaccaagcccggctcg
gccacggtgccgttccccggtattcgcacggccctgctcgacgccaacgccaacgaactc
acggtcggcggtggattgttggccatcacgcacccctggcccagcatgctgcgcacgatc
tggggtgacgatcagcgatacgtggacacgtacttctcgaagtggcccggtcgtcccgat
ctgtacttcccgggcgacggggccaaactcgacgaagacggctacctctggatcctcggc
cgcgtcgatgatgtgctcaacgtgtccggccaccgcatcggcacgatggaagtggaaagc
gccttggtcgaccatccgtcggtcgcggaagctgccgtggtgggcaaacatcacgatctc
aaggggcaggccatcgcagccttcgtgacattgcgtgccggattcaccgccagtggcagc
ctgcgcgacgaactgcgcgatcacgtggcacagaagatcggtgcgctggcccgtcccgac
gacatcctgttcagcgccgatttgccgaagacgcggtcgggcaagatcatgcgccgcctg
ctgcgggatatcgccgaaggccgcgcactgggcgacaccacgacgctggccgatccgtcg
gtggtcgcctcactcaaggatcagtacgaggcgcaggaatcgtaa

DBGET integrated database retrieval system