KEGG   Gemmatimonas aurantiaca: GAU_2710Help
Entry
GAU_2710          CDS       T00878                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00500  Starch and sucrose metabolism
gau01100  Metabolic pathways
gau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GAU_2710 (glgB)
Enzymes [BR:gau01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     GAU_2710 (glgB)
Exosome [BR:gau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GAU_2710 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: BAH39752
NITE: GAU_2710
UniProt: C1AAF4
Position
complement(3184059..3186674)
Genome map
AA seq 871 aa AA seqDB search
MEPAALPSWPYTSGMPALSLPPAPDEAATRLVRGESVSPHDLLGAHSATIDGVSGVVIRA
WQPRARRIDVVIGEQHLPMQREVSGLYSVFVPDRKLPLRYRFEMTDDEGQVRTFDDPYRF
LPTIGDVDLHLFNEGRHLRLWEKMGAHVRTIDGVDGTAFTVWAPNATRVSVSGDFNRWDG
RAHTMRRLGASGVFELFIPGIGAETLYKFEIRTRTGALRVKTDPFAAKLEQGPGHASIVQ
ARSRYPWRDGRWLAERADSDLRREPMLVYEVHLGSWLRGDDNRLLSYREIAPRLASHVST
LGFTHVELLPVQDHPFGGSWGYQVGGYFAPNSRHGSPDDLRFLVDTLHEAGIGVLLDWVP
AHFPKDDWALRRFDGTACYEHEDPRLGDHPEWGTHIFNYARHEVRNFLVANALYWIEEFH
LDGLRVDAVASMLYLDYGREAGQWLRNRFGGRENLEAVAFLKQLNLAMQSLHPGVVTIAE
ESTSWPKVTAPIRDGGLGFTFKWNMGWMHDTLDYFRVDPFFRKGAHEKLTFAIWYEYSER
FMNPLSHDEVVHLKRSLLEKMPGDMWQKFANLRTLLGYSITRPGKSLFFMGTELAPHREW
NHDVSLEWELLEDPRRRGLSDFLQALQQAYRAHACFWRSDHEPAGFRWIDVADREQSVLS
YARFDGDAHALVVLNLTPVPRDQYRLGVPRAGRYRLLLNSDASAFGGSGYPVFEEVTTDA
MPYHGFDASIVLSLPPLAMLVLLPEGDGATQLTAPSSEGATSKPVKVKTAKPKTEKAKTT
KSDVATLEVKKPKTTKRKATTPKVARPTITKSAPEKPKVATPKVVKTESPKSATPKVETP
KTQPAVNTPKTVKPKVAKPRTARAPKKDPSE
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atggaacccgccgcgctcccgtcctggccctatacttcaggtatgccagcgctctctcta
ccgccggcccctgacgaggcggctactcgcctggttcgcggcgaatcggtcagtccacat
gatctgcttggtgcccattccgccacgatcgacggtgtctcgggcgtcgtgatccgggca
tggcagccgcgtgctcgtcgcatcgatgtggtgatcggcgaacagcacctgcccatgcag
cgcgaagtatccgggttgtacagcgtattcgtaccagaccgaaaactgccgctgcgctat
cggttcgagatgaccgacgatgaagggcaggtgcgcacgttcgatgacccgtatcgtttt
ctgcccacgattggcgatgtggatctgcacctcttcaacgaggggcggcatctgcggttg
tgggaaaagatgggtgcccatgtgcgcaccatcgatggggtggatggtacagcgttcacc
gtgtgggcacccaatgccacgcgtgtctcggtctccggggatttcaatcgctgggacgga
cgagcgcacaccatgcggcgactgggtgcgagcggggtgttcgagttgttcattccgggc
atcggtgccgagacgctgtacaagttcgagatccgcacgcgcacgggcgcgctgcgtgtg
aagaccgatccgtttgcggcgaaactcgaacagggccctgggcatgcatcgattgtgcag
gcccgcagtcgatatccctggcgtgatgggcgatggttggcggaacgtgccgactccgat
ctgcgcagggagccgatgctggtgtacgaagtgcacctcggctcgtggctgcgtggcgat
gacaatcgcctgttgtcgtatcgcgagattgcgccgcgactggcgtcgcatgtgagcacg
ctcggtttcacacacgtggaactgttgccggtgcaggatcatccgttcggtgggtcgtgg
ggctatcaggtgggtggctacttcgccccgaactcccgtcacggatcaccagacgatttg
cgattcctcgtggataccctccacgaggccgggatcggtgtactgctcgactgggtgcct
gcacacttccccaaggacgactgggcactgcgtcgattcgacggcaccgcctgctacgag
catgaagacccgcgcctcggcgatcatcccgagtggggcacccatatcttcaactacgcg
cgtcacgaggtccgcaattttctcgtggccaatgcgctgtactggatcgaagagtttcac
cttgatggcctgcgtgtcgacgctgtggcctcgatgctgtatctcgactacgggcgcgaa
gcggggcagtggctgcgcaatcgtttcggtggacgcgagaacctcgaagccgttgcgttc
ctcaagcagctcaacctggcgatgcagtcgctgcatcccggcgtggtcaccatcgccgaa
gagagcacgtcgtggcccaaggtcacggcaccgattcgcgacggcggcctcggtttcacg
ttcaagtggaacatgggctggatgcacgacacgctggactacttccgtgtcgaccccttc
ttccggaagggcgcccacgaaaagctcacgttcgccatctggtacgagtacagcgaacgc
ttcatgaaccccctctcgcacgacgaggtggtgcatctcaagcggtcgttgctggagaag
atgccaggtgacatgtggcagaaatttgccaacctgcgcacactgctcggctattcgatc
actcggcccggcaagtcgctgtttttcatgggcacggagctcgcgccgcatcgggagtgg
aatcacgacgtgagtctcgagtgggaactgctcgaggatccacggcgtcgcggtctctcc
gacttcctgcaggcgttgcagcaggcctaccgtgcgcatgcctgcttctggcgttcggac
cacgaacccgccgggttccggtggatcgacgtggcagatcgtgagcagtcggtactctcg
tacgcgcgtttcgacggagacgcgcatgcactcgtggtgctcaacctgacgcccgtgccg
cgcgatcagtaccggctgggagtgccccgtgctggtcggtatcgcttgctcctcaattcg
gatgcgagcgcgttcggtgggagcggctatccggtgttcgaagaagtcaccaccgacgcc
atgccatatcacggcttcgatgcgtcgatcgtgttgtcgctgcctccgctggccatgctg
gtgctgctgcctgagggtgacggagcaacacagctcacggcgccgtcgtcggaaggggca
acgtcgaaaccggtcaaggtaaagactgccaagcccaagaccgaaaaggccaagacgacg
aagtccgacgtggcgacgctggaagtcaaaaagccgaagacaacgaaacgcaaagccacc
acgccgaaggtggccaggcccaccatcacaaagtcggcgcctgaaaagccgaaggtggca
acaccaaaggtcgtgaagactgaatcgccgaagtcggcgacgccgaaggtcgagaccccg
aaaacccagcccgctgtgaacacgccgaagactgtcaaaccgaaagtcgccaagccccgc
actgcccgggcgccgaagaaggatccatcggaatga

DBGET integrated database retrieval system