KEGG   Gemmatimonas aurantiaca: GAU_2825Help
Entry
GAU_2825          CDS       T00878                                 

Definition
cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
gau  Gemmatimonas aurantiaca
Brite
Enzymes [BR:gau01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     GAU_2825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3326196..3327464)
Genome map
AA seq 422 aa AA seqDB search
MMRSPRSGVIGLTACAALAIAGSAVFPPDGAGLSAQPPAGGARAASATKPAAKPAATPAA
KPTVKPAGAVAYRWELPAGFPEPVVPADNPMTHEKVALGRHLFYDTRLSGNGTFSCASCH
LQSRAFADALPRAVGSTGEVHPRGSMGLANIAYSPALTWANPLMRSLEQQALVPMFGEDP
VELGLSGQEQQLLARVREVPQYKALFAAAYPGSGDPVSLDHIVKAIASFQRTMISGRSPY
DAFKQGRSAAISASARRGEELFFSEKTECFHCHGGFNFTGTVNYVGKGFVEIEFHNTALY
NIDGQGKYPAPNTGVESVTHEEEDMGKFKAPSLRNIAVTAPYMHDGSIATLEEVIEHYNA
GGRTVKSGPNAGVGAESPLKSEFIKPMDLTPQEKRDLVAFLRSLTDSTFLRDPRFTNPWR
TR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgttccccacgttccggggtcatcggacttacggcatgcgccgctctggccatc
gcgggatcggcggtcttcccgccggatggcgcagggctgagtgcgcagccgccggccggt
ggcgcacgggccgcgtcggccacgaagccggccgctaaacccgcagcaacacccgcagca
aaaccgaccgtcaaaccggccggggcggtcgcctatcgctgggagctgcccgccggtttc
ccagagccggtggtgccggccgacaatccgatgacccatgaaaaggtggcgctgggccgt
cacctgttctacgacacgcgtctgtccggcaacggcacgttcagttgtgccagttgccac
ctgcagtcgcgtgcctttgccgacgcgctcccgcgcgctgtcggttccaccggcgaggtc
catccccgtggcagtatgggactcgccaacatcgcctacagcccggcgctcacatgggcc
aatccgctcatgcggtcgctggagcagcaggcgttggtgccgatgttcggggaggatccg
gtggaactcggactctccgggcaggagcagcagttgctcgctcgcgtgcgggaggtgccg
cagtacaaggccctctttgccgcagcgtatcccgggagcggtgatcccgtgtcgctcgat
cacatcgtgaaggcgattgccagctttcagcgcacgatgatcagtggacggtcaccctac
gatgccttcaagcaggggcgttcggcggccatcagcgcgtcggcacgtcggggggaagag
ctcttcttcagtgagaagaccgagtgcttccattgccacggcgggttcaacttcaccggc
accgtgaactatgtggggaaggggttcgtggagatcgaattccacaacaccgcgctctac
aacatcgacggacaggggaagtatcccgcaccgaataccggggtagaatcggtgacgcat
gaggaggaggacatggggaagttcaaagccccgagccttcgcaacatcgcggtcacggcg
ccctacatgcacgacggcagcatcgccacgctggaagaggtgatcgagcactacaacgcg
ggtggacgtacggtgaaaagtggtccaaacgccggtgtgggtgccgagagcccgctcaag
agtgagttcatcaagccgatggatctcactccgcaggaaaagcgcgacctggtggccttt
cttcgttccctgacagacagcacgtttctgcgcgatccgcgcttcaccaatccctggaga
acccgatga

DBGET integrated database retrieval system