KEGG   Gemmatimonas aurantiaca: GAU_2856Help
Entry
GAU_2856          CDS       T00878                                 

Gene name
fadJ
Definition
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase (EC:4.2.1.-)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GAU_2856 (fadJ)
   01212 Fatty acid metabolism
    GAU_2856 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GAU_2856 (fadJ)
   00650 Butanoate metabolism
    GAU_2856 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    GAU_2856 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    GAU_2856 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GAU_2856 (fadJ)
   00310 Lysine degradation
    GAU_2856 (fadJ)
   00380 Tryptophan metabolism
    GAU_2856 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GAU_2856 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GAU_2856 (fadJ)
   00281 Geraniol degradation
    GAU_2856 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    GAU_2856 (fadJ)
Enzymes [BR:gau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     GAU_2856 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GAU_2856 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     GAU_2856 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3355216..3357429)
Genome map
AA seq 737 aa AA seqDB search
MSRAASDVSGAGLTVATLPGTLLLEDSTVGLSLRVHEGIALIAYDQPGSPVNTLNSRVGP
VFEQFFLRIEQDAAIVAAVLVSGKTDSWIAGADIEELQRITAPVDGERLSRSGQLLLDRL
AALRKPVIAAIHGAALGGGLEVALACHHRIITDHAKTVLALPEVQLGLIPGAGGTQRLPR
TVGLQVALDLILTGKNVRARKALPMGLVHELVHPAILLDVAMQRARQLAHGDRSAVRERR
PGLVERALEENSVGRAIIFRKARESVTKKTGGHYPAPFAALDVIERGYRESFAAGLLEEA
KRFGELAVSPECRQLAYLFFATTSLKKDTGLPAGQNVAPRAVHKLGVLGAGFMGAGITAV
AVQAGTVVRLKDGTVERLASGFKAVRDVVRERLVKRQITRVQFDDTMSLVGGTVDYRGFA
NVDLVIEAVFEDLDVKHQVLREVEETTPAAIFASNTSTIPIRDIARAAKRPEQVLGMHFF
SPVHRMPLLEVIVTPETSAETTATAVAYGKQLGKTVIVVQDGAGFYVNRILAPYLNECGR
MVDEGASIEDIDKALVQFGFPVGPFTLLDEVGLDIAGKSGPIMEAAFGPRMQPSATLRAV
IASGRLGRKARKGFYRYDADGKRQGVDDSIYAMTPVGARRRTLPVEEIQQRAVLPLLNEA
VRCLDEGIIRSPRDGDIGAVFGIGFPPFRGGPFRLLDTMGLANVVAQLDALHARFPGRFE
VAKLLRARADRQQPFHP
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtgccgcatccgatgtatcgggcgcagggctgacggtggccacgctgcccggc
acgctgttgctcgaggacagtacggtgggactgtcgttgcgggtgcatgaaggcatcgcg
ctgatcgcctacgaccagccgggatcgccggtgaacacgctgaacagtcgcgtcgggccg
gtgttcgaacagttcttcctgcgcatcgaacaggacgcggccatcgtcgcagccgtgttg
gtgagtggcaagacagatagctggattgccggcgccgatatcgaagaactgcagcgcatc
accgccccggtggatggtgaacggctctcccgcagcggacagttgttgctcgaccgcctc
gccgcgctcaggaagccggtgattgcggccattcatggggcggcgctgggcggcggcctc
gaagtggcgctggcctgtcatcaccgcatcatcaccgatcatgcgaagacggtgctggcg
ttgcctgaggtgcagctcgggttgataccgggcgccggcggcacacagcggctgccacgc
acggtgggtttgcaggtggccctcgacctgattctcaccggcaagaatgtgcgcgcccgc
aaggcactgccaatggggctcgtgcacgagttggtgcacccagcgatcctgctcgatgtg
gccatgcagcgtgcgcgccagttggcgcacggcgatcgatcggcggtacgggagcggcgt
cccggtcttgtcgagcgtgcgctcgaggaaaactcggtgggacgcgcgatcatctttcgc
aaggcgcgcgagagcgtgacgaagaagaccggtggtcactatccagcgccgtttgctgcg
ctcgacgtgatcgaacgcggctatcgcgagtcgtttgccgccggcctgctcgaggaagcg
aagcgttttggcgaactcgccgtgtcgccggaatgccgtcagctcgcctatctgtttttt
gccaccacctcgctcaagaaagacacagggctccccgccggccagaacgtggcgccacgt
gctgtgcacaagctcggcgtgctgggagcgggattcatgggggctggcatcacggcggtg
gcggtgcaagccggcacagtggtgcggctcaaggacggtacggtcgaacggctggcgtcg
gggttcaaggcggtgcgcgatgtggtgcgcgaacgcctcgtcaagcgccagatcacgcgg
gtccagttcgacgacaccatgtcactggtgggcggcaccgtggattaccgcggcttcgcc
aatgtcgatctggtgatcgaagccgtgttcgaggatctcgatgtgaagcatcaggtgctg
cgtgaggtcgaggaaaccacaccggcggcgatctttgcgtcgaataccagcaccatcccc
attcgcgatattgcgcgcgccgccaaacggccggagcaggtgctgggcatgcacttcttc
tcgcccgtgcatcgcatgccgctgctcgaggtgattgtcacgccggagaccagtgcggag
accacggcgaccgccgtggcctacggcaagcagcttggcaagacggtgatcgtcgtgcag
gatggcgcggggttttatgtgaaccgcatcctggcgccatatctcaacgagtgcggccgg
atggtcgacgaaggggcgtccatcgaggacatcgacaaggcgttggtgcagttcggtttt
ccggtcggaccgttcacgctgctcgacgaagtggggctcgatattgccggcaagtcgggt
ccgatcatggaagccgcctttgggccacgcatgcaaccgtcggcgacactgcgcgccgtc
atcgcgagtggccggcttggtcgcaaagcccgcaaaggcttctatcgttacgacgccgat
ggcaagcggcagggtgttgacgattcgatctacgccatgacgccggtcggtgcacggcgg
cgcacgcttccggtcgaggaaattcaacagcgggccgtgctgccgctgctcaatgaagcg
gtgcgttgcctcgacgaaggcatcatccgctccccgcgtgatggagatatcggtgcggtg
tttggcatcggtttcccaccgttccggggcggaccgtttcggctgctggacaccatgggg
ctagccaatgtcgttgcccaactggatgccctgcacgcacgtttccctggacggttcgag
gtggccaagctgcttcgggcccgcgccgatcgccaacagcccttccatccgtga

DBGET integrated database retrieval system