KEGG   Gemmatimonas aurantiaca: GAU_2900Help
Entry
GAU_2900          CDS       T00878                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00010  Glycolysis / Gluconeogenesis
gau00071  Fatty acid degradation
gau00350  Tyrosine metabolism
gau00625  Chloroalkane and chloroalkene degradation
gau00626  Naphthalene degradation
gau01100  Metabolic pathways
gau01110  Biosynthesis of secondary metabolites
gau01120  Microbial metabolism in diverse environments
gau01130  Biosynthesis of antibiotics
gau01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GAU_2900
  Lipid metabolism
   00071 Fatty acid degradation
    GAU_2900
  Amino acid metabolism
   00350 Tyrosine metabolism
    GAU_2900
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GAU_2900
   00626 Naphthalene degradation
    GAU_2900
Enzymes [BR:gau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GAU_2900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: BAH39942
NITE: GAU_2900
UniProt: C1ABR5
Position
complement(3409145..3410278)
Genome map
AA seq 377 aa AA seqDB search
MYAPIRAAVLRTTALPRPYGDSRPLHIESVRLSAPQEQEVRVRIAAAGLCHSDLSVVDGN
RPRPLPMVLGHEAAGEVIEVGAGVRDLMVGDHVVFSFVPQCGHCAPCRSARPALCEPGAA
ANGAGELLDGGRRLRDMNDTPMHHHLGVSGFAEEVVVSRQSVVRVDRSLPFEIGALFGCA
VMTGVGAIVNTAKLRLGESVLITGLGGIGFAALLGALASGAGQVVVADVSDDKLQQALAL
GAHAAVNSGADNALERVRGLTGGGADVGLECAGVVAALDFTWRGTRRGGRTVTVGLPHPS
QTLSISPVQLVAEERTLQGSYLGSCVPSRDIPAYIALYQSGRLPVDKLLTHRLSLDEIND
GFDRLARGEAIRQVILF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtacgctccgatccgcgccgcagtgttgcgtacgacggcacttccacgcccgtatggc
gacagccgcccgttgcacatcgaatccgtgcggctttctgcgccacaagagcaggaagtg
cgtgtgcgcatcgcggcggcggggctgtgtcactccgatctgtccgttgtggatggcaat
cgcccacgtccactgcccatggtattggggcacgaggcggccggtgaagtgatcgaggtg
ggggccggtgtccgtgatctcatggtcggtgatcacgtggtgttttctttcgtgccacaa
tgcggacactgtgcgccatgccggagcgcacggccggcgctgtgcgagcccggggccgca
gcaaatggcgcgggagaactactggatggtggccgtcgcctgcgcgacatgaacgacaca
ccgatgcatcatcatctcggggtgtcgggattcgccgaagaggtcgtggtgtcgcggcag
tccgtcgttcgggtggatcgttcgttgccgttcgagatcggtgccctgttcggatgtgcg
gtgatgacgggcgtgggcgccatcgtgaacacggccaagctgcgtttgggcgagtcggtg
ctgatcaccggtctgggcggtatcggctttgccgcgctgctgggcgcgttggcatcgggc
gccggtcaggtggtcgtggccgatgtcagtgacgacaaacttcagcaagccttggccctt
ggggcccatgctgcagtgaacagtggtgctgacaacgcgctggaacgtgtgcgcgggctg
acgggcggtggagccgatgtggggctcgagtgtgcgggcgtggtcgcggcgctggacttc
acctggcgcggcacacggcgtggtggccggaccgtgacagtgggactgccgcatccgtcg
cagacgctgtccatttccccggtgcagttggtcgccgaggagcgcacgttgcaggggtcc
tacctcggcagttgtgtgccgtcgcgcgacatcccggcgtatatcgcgctgtatcaatcc
gggcgtctgccggtggacaagttgctcacccatcgtctgtcgctggacgagatcaacgac
ggattcgatcggctcgcgcgtggcgaggcgattcgtcaggtcatcctgttctga

DBGET integrated database retrieval system