KEGG   Gemmatimonas aurantiaca: GAU_2999Help
Entry
GAU_2999          CDS       T00878                                 

Gene name
phoD
Definition
putative phosphodiesterase/alkaline phosphatase D (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GAU_2999 (phoD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    GAU_2999 (phoD)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GAU_2999 (phoD)
Enzymes [BR:gau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     GAU_2999 (phoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3535101..3536678
Genome map
AA seq 525 aa AA seqDB search
MSNDFDFRQLLGVGGSRRDFLRVGGSAAGLIMLGTLPATRSDAQRRIPDFPFTLGIASGD
PTSTGVVLWTRLAPDPLRGGGMPAQRVPVRWELADDEQFSRIVQRGDVLALPELAHSVHV
EVEGLAPDRGYWYRFISGGIVSQLGRTRTAPAPGAKVDRLDLVFASCQHYESGYYTAHRH
LASEDVRLVVFLGDYIYEGGASPSGVRRHTGPEIMTLEDYRNRYALYKSDLDLQASHAAF
PWTVTWDDHEVDNNYAGSISERYDAADAFLMRRAAAYQAYYEHMPLRRASMPKGADMRLY
RRFQYGDLLSLSMLDTRQYRTDQPCGDGVTPHCAESLSPEATILGTEQERWLVDGFAASQ
ARWNLLGNQLPLADIDRIAGPAVGYQMDQWTGYSRCRDRVVAAMHARKLANPIVVTGDVH
QSWVADFHLDPANSKSPIVGTEFVGTSITSGGDGAAMPASGQAILDENPHVHYYNAQRGY
VRCAITPDRWQSDYRVLTQVSRPDQPIRTDRSFVVENGRPGAQKA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgatttcgatttccgccaactcctcggggttggcggaagccgacgcgatttc
ctgcgcgtcggtggcagcgcggcgggcctgatcatgctggggacgctcccggccacccga
tccgatgcacagcgccgcattcccgactttccgttcactctgggcatcgcatccggcgac
ccgacgtcgaccggcgtggtgttgtggacacgcctggcgcctgacccgctccgaggtggt
ggcatgccagcgcaacgtgtgccggtgcgctgggaattggccgacgacgaacagttttcg
cgcattgtgcagcgtggcgacgtactcgcattgccggagctcgcccattcggtgcacgtc
gaagtggaaggactcgcccccgatcgtggctactggtaccgcttcatttccggcggcatc
gtgagccaactgggccgcacacgaaccgctcccgcgccgggtgccaaggttgaccgtctc
gatctggtgttcgcctcgtgccagcactacgagtccggctactacaccgcgcatcgccac
ctggcctcggaggatgtgcgactcgtggtgttccttggcgactatatctacgaaggcggt
gcatcgccgagtggggtgcgccgacacaccggtcccgagatcatgacactcgaggactat
cgcaaccggtacgcactgtacaagagcgatctcgacctgcaggcatcccacgcggcgttc
ccctggacggtgacctgggacgaccatgaggtggacaacaactacgccggcagcatttcc
gaacggtacgatgcggcggatgcatttcttatgcggcgcgcggcggcgtatcaggcgtat
tacgaacacatgccgctgcgccgtgcgtcgatgcccaagggggccgacatgcggttgtat
cgtcgcttccagtatggtgatctgttgtcgctgagcatgctcgatacgcggcagtaccgt
acggaccagccctgcggcgacggcgtgacgccgcactgcgcggagtcgttgtcgcccgaa
gccaccatcctcggcacggagcaggagcgttggctggtcgacggcttcgccgcatcacag
gctcgctggaacctgcttggcaatcagttgccgttggcggacatcgaccgcatcgccggt
ccggccgtgggctatcagatggaccaatggacgggatacagtcgctgccgggatcgtgtc
gtcgcggcgatgcacgcccgcaagctcgccaatcccatcgtggtcacgggtgacgtgcac
cagagctgggtcgcggacttccatctcgatccggcaaacagcaagtcgccgatcgtcggg
acggagttcgtgggcacgtcgatcacgtcgggaggcgacggcgccgcgatgcccgcttcc
gggcaggccattctcgacgagaacccgcacgtgcactactacaatgcccagcgcggctac
gtacgatgtgccatcacgccagaccggtggcagagcgactatcgtgtgctgacgcaggtg
tcacggcccgatcagcccattcgcacggaccgctcgttcgtcgtggaaaacggacgcccg
ggcgcgcagaaggcgtag

DBGET integrated database retrieval system