KEGG   Gemmatimonas aurantiaca: GAU_3161Help
Entry
GAU_3161          CDS       T00878                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GAU_3161
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GAU_3161
  Lipid metabolism
   00071 Fatty acid degradation
    GAU_3161
  Amino acid metabolism
   00350 Tyrosine metabolism
    GAU_3161
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GAU_3161
   00626 Naphthalene degradation
    GAU_3161
Enzymes [BR:gau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GAU_3161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3732393..3733430
Genome map
AA seq 345 aa AA seqDB search
MKAVQMVRAGDPVVSHEVPVPSLGPDDVLVRVRAAGICHSDAHYRSGRSPAHPLPLTLGH
EIAGEVAAVGSDVTTLAIGARVALHYLVICGACDDCLAGREQFCRTGLMLGHYTNGGWAE
YIVVPAWNAVPLPDAVSYEHGAVMMCSSSTSLHALRKGRMQPGESVLVIGAGGLGMSAIQ
LATHLGASQVIAVDRDAKKLALAAQFGATPVSAADLTVDQVVAAVRDASNGRGVNVALEL
VGSVDTVQVSLKALAPLGRAAVVGLNNVAVPVDSYRDIIGREAELIGSNDHLRSELEELM
ALAAAGHLDLRHVVTNTVPLDADAINGVLDALDRHAAPVRTVILP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtgcagatggtgcgcgcgggcgatccggtcgtgtctcatgaggttccggta
ccatcgctgggccccgacgacgtgctggtgcgcgtgcgggccgccggcatctgtcactcg
gatgcacactatcggagcggtcgctcaccagcgcacccgctcccgctcaccctcggacat
gagatcgccggagaagtcgcggccgtcggctcggatgtcacgacgctggcgatcggcgcc
cgggtggcgctgcactacctcgtgatctgcggcgcctgcgatgactgcctcgccgggcgc
gaacagttctgccggaccggtctcatgctcggccactacaccaatggtggctgggccgag
tacatcgtggtaccagcgtggaacgccgtaccactgcccgatgcggtgtcgtacgagcat
ggcgcggtcatgatgtgttcgtcttccacgtcgctgcatgcgttgcgcaaaggacggatg
cagcccggtgaatcggtgcttgtcatcggcgcggggggactgggcatgtcggccattcag
ttggcgactcacctgggcgcgtcgcaggtcatcgccgtggaccgggatgccaaaaagctc
gcgctggcggcgcagtttggtgcaacgccggtgtcggcggcggacctcaccgtggatcag
gtcgtggcagccgttcgtgatgcgtcgaacggccgcggtgtgaatgtggccctcgaactg
gtgggcagtgtcgacacggtgcaggtgtccctgaaggccctcgctcccctcggccgcgct
gccgtggttgggctcaacaacgtcgccgtgccggtggacagctaccgcgacatcattggc
cgcgaggcagagctgatcgggtcaaacgatcacctgcgcagtgagctcgaggagctgatg
gcactggccgccgcaggacacctcgatctgcgtcacgtcgtcaccaacaccgtgccactc
gacgccgacgccatcaatggggtgctcgacgcgctcgatcgtcacgccgcaccggtgcgc
accgttattctgccgtag

DBGET integrated database retrieval system