KEGG   Gemmatimonas aurantiaca: GAU_3161Help
Entry
GAU_3161          CDS       T00878                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00010  Glycolysis / Gluconeogenesis
gau00071  Fatty acid degradation
gau00350  Tyrosine metabolism
gau00625  Chloroalkane and chloroalkene degradation
gau00626  Naphthalene degradation
gau01100  Metabolic pathways
gau01110  Biosynthesis of secondary metabolites
gau01120  Microbial metabolism in diverse environments
gau01130  Biosynthesis of antibiotics
gau01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GAU_3161
  Lipid metabolism
   00071 Fatty acid degradation
    GAU_3161
  Amino acid metabolism
   00350 Tyrosine metabolism
    GAU_3161
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GAU_3161
   00626 Naphthalene degradation
    GAU_3161
Enzymes [BR:gau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GAU_3161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Sacchrp_dh_NADP PALP 2-Hacid_dh_C ThiF Shikimate_DH PrmA
Motif
Other DBs
NCBI-ProteinID: BAH40203
NITE: GAU_3161
UniProt: C1ACH6
Position
3732393..3733430
Genome map
AA seq 345 aa AA seqDB search
MKAVQMVRAGDPVVSHEVPVPSLGPDDVLVRVRAAGICHSDAHYRSGRSPAHPLPLTLGH
EIAGEVAAVGSDVTTLAIGARVALHYLVICGACDDCLAGREQFCRTGLMLGHYTNGGWAE
YIVVPAWNAVPLPDAVSYEHGAVMMCSSSTSLHALRKGRMQPGESVLVIGAGGLGMSAIQ
LATHLGASQVIAVDRDAKKLALAAQFGATPVSAADLTVDQVVAAVRDASNGRGVNVALEL
VGSVDTVQVSLKALAPLGRAAVVGLNNVAVPVDSYRDIIGREAELIGSNDHLRSELEELM
ALAAAGHLDLRHVVTNTVPLDADAINGVLDALDRHAAPVRTVILP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtgcagatggtgcgcgcgggcgatccggtcgtgtctcatgaggttccggta
ccatcgctgggccccgacgacgtgctggtgcgcgtgcgggccgccggcatctgtcactcg
gatgcacactatcggagcggtcgctcaccagcgcacccgctcccgctcaccctcggacat
gagatcgccggagaagtcgcggccgtcggctcggatgtcacgacgctggcgatcggcgcc
cgggtggcgctgcactacctcgtgatctgcggcgcctgcgatgactgcctcgccgggcgc
gaacagttctgccggaccggtctcatgctcggccactacaccaatggtggctgggccgag
tacatcgtggtaccagcgtggaacgccgtaccactgcccgatgcggtgtcgtacgagcat
ggcgcggtcatgatgtgttcgtcttccacgtcgctgcatgcgttgcgcaaaggacggatg
cagcccggtgaatcggtgcttgtcatcggcgcggggggactgggcatgtcggccattcag
ttggcgactcacctgggcgcgtcgcaggtcatcgccgtggaccgggatgccaaaaagctc
gcgctggcggcgcagtttggtgcaacgccggtgtcggcggcggacctcaccgtggatcag
gtcgtggcagccgttcgtgatgcgtcgaacggccgcggtgtgaatgtggccctcgaactg
gtgggcagtgtcgacacggtgcaggtgtccctgaaggccctcgctcccctcggccgcgct
gccgtggttgggctcaacaacgtcgccgtgccggtggacagctaccgcgacatcattggc
cgcgaggcagagctgatcgggtcaaacgatcacctgcgcagtgagctcgaggagctgatg
gcactggccgccgcaggacacctcgatctgcgtcacgtcgtcaccaacaccgtgccactc
gacgccgacgccatcaatggggtgctcgacgcgctcgatcgtcacgccgcaccggtgcgc
accgttattctgccgtag

DBGET integrated database retrieval system