KEGG   Gemmatimonas aurantiaca: GAU_3174Help
Entry
GAU_3174          CDS       T00878                                 

Definition
putative alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gau00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:gau00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:gau02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3751415..3753043
Genome map
AA seq 542 aa AA seqDB search
MTDPTISRRLFLGATVASGAALLRSPQPASIWSARGLLEGAPGIVTSERLRPVLPGGVQT
GDVLHDRAILWGRVDRPAQCLVEWSTSEKFTNVRRVKGGVTNAASAFTSHLDVTGLPPGQ
TIHYRMQYESADSPGAFSEPVIGSLRTPQRPDARGNVRPVRIAWSGDMVGQGWGIDEARG
GLRIYDALRRAEPDVFVHSGDNIYADQPLLAEVKLDDGTIWKNVVTEAKSKVAETLDEFR
GCFAYNMLDPHAQKFGSSVPLITQWDDHEVVDNWFHDLVLQNDTRFTEKRVRVLAERAKQ
AVFEFLPIRRHAVERDRIYRSFSYGPLVEIFVVDLRSYRGANSGNKQTELNAASSILGPD
QFKWLEQGLKNSRATWKVVACDMPIGLIVPDRMRNGERNYEAIANADNGVPLGRELEIAQ
LLRSLKAGNVRNVVWVTADVHYAAAHHYAPDRAAFTEFNPFWELVAGPMHSGTFGPNQLD
GTFGPEVRFASPAPKPNRPPSDNMQFYGTLDVDPRTRALTAGLWDVTGKRLWSIEMPDET
AR
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccccacgatctcccggcgtctgtttcttggtgccactgtcgcttccggcgcc
gccctgctgcgttctccgcagcccgcgtcgatctggtcggcgcgcggattgctcgaggga
gcaccggggatcgtgacctcggagcgcttgcgaccggtgttgccgggcggtgtgcagacc
ggcgacgtgctgcatgaccgcgcgattctctgggggcgcgtggatcggccagcccagtgc
ctggtggagtggtccacgtcggagaagttcaccaacgtgcgacgggtaaaaggtggtgtg
accaacgcagcgtcggccttcacatcacatctcgacgtgacaggcctgccccccggtcaa
accattcactatcgcatgcagtacgaaagtgcggactcgccgggtgcgttcagcgaaccg
gtgatcggcagtctccgcacccctcagcgccccgatgcgcgcggcaacgtacgccccgta
cgcattgcctggtcgggcgacatggtcggccagggatggggcatcgacgaagcgcggggt
ggtctgcgcatttacgacgccctgcgccgggccgagcccgatgtgttcgtgcactcgggt
gacaacatctacgccgatcagcccctgctggctgaagtgaagctcgacgacggtacgatc
tggaagaacgtcgtcaccgaagccaagtcgaaggtggccgaaaccctcgacgagttccga
ggctgttttgcgtacaacatgctcgatccgcatgcacagaagttcggatccagcgtgccg
ctcatcacccagtgggatgatcacgaggtggtggacaactggttccacgatctggtgctg
cagaacgacacgcgtttcaccgaaaagcgcgtgcgcgtgctggccgagcgggccaagcag
gcggtgttcgagttcctgcccatccggcgccatgccgtggagcgggatcgcatctatcgc
tcgttctcgtatgggccactggtcgagatcttcgtggtggacctgcgcagctatcgcggc
gccaactcgggcaacaaacagacggagctcaatgcggcgtcctccattcttggccctgat
cagttcaagtggctggagcaagggctcaagaacagccgcgccacgtggaaggtcgtggcc
tgcgacatgccgatcggcctgatcgtccccgatcgcatgcgcaacggtgagcgcaactac
gaggccattgccaacgccgacaacggcgtgccactcgggcgggaactcgagattgcgcag
ttgttgcgctcactcaaggcaggcaacgtccgcaatgtggtgtgggtgacggccgacgta
cactatgccgccgcgcaccactatgccccggaccgcgcagccttcaccgagttcaatccg
ttctgggaactcgtggcgggcccgatgcattccggcacctttggcccgaatcaactggat
ggcacttttggccccgaagtgcggtttgcgagccccgccccaaagccgaaccgtccgccc
agcgacaatatgcagttctacggcacgctcgatgtggatccgcgcacacgcgcactcacg
gccggtctgtgggatgtgaccggcaagcgcctctggagcatcgagatgccggacgaaacc
gcgcgataa

DBGET integrated database retrieval system