KEGG   Gemmatimonas aurantiaca: GAU_3175Help
Entry
GAU_3175          CDS       T00878                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gau00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GAU_3175 (recD)
Enzymes [BR:gau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     GAU_3175 (recD)
DNA repair and recombination proteins [BR:gau03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     GAU_3175 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 Helicase_RecD AAA_11 DUF2075 AAA_22 PhoH AAA_16 UvrD_C PIF1 AAA_5 AAA_28 AAA_33 UvrD-helicase NTPase_1 KTI12 AAA_18 NACHT Mg_chelatase T2SSE AAA_29 AAA AAA_24 AAA_17 Herpes_Helicase
Motif
Other DBs
NCBI-ProteinID: BAH40217
NITE: GAU_3175
UniProt: C1ACJ0
Position
complement(3753056..3754795)
Genome map
AA seq 579 aa AA seqDB search
MSRLDEAFADLVVRMAAVQAGTTEALLAREVLANTALLVSAERGMGNSCVDLAAHAGRII
TLGSRTVQFPALDDWGDVLRASGVCARVPHTQDANVPLFVLEGTRLYLLRYHRAEVRLAE
AIVHRAQQATPVEALPDTPRFHALFPAVDGVVDWQARAAATALASPLVFVTGGPGTGKTT
VAARLLALLLHRDPTLTFALAAPTGRAAARLSEAIGAAALRDALHELAPSLPGVSGKTLH
RLLGYHTATQRFRHHAQRPLAEDVVIVDEASMIDVLMMDALFAALKPSARLIVLGDPDQL
ASVDTGFVLGDVTRAAHDAVKSSAIRRSVVRLAYSWRFGQQVGIGLLAEATRVGESQQAM
RALQDTALTDVAWQLPHRSAQELLAPVEPHVQAFLATDTPVAALAALARFRVLCALRDGP
GGVTGLNALTEGWLQRQGRAVMGWYDHRPVLVTANDAATQLYNGDVGVTLAIDGVPMVHF
PASDGGVRSFMPSQLPAHETAWAMTVHKSQGSEFDHVLVVLPEADSRVLTRELLYTAVTR
ARRSVTISGSDRMIEAAIHRSVVRGSGLTDRLLAQAGAS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcgtctcgacgaggccttcgccgatctcgtggtgcgtatggccgccgtgcaggcg
ggcaccaccgaagcgctgctggcccgtgaagtgcttgccaataccgcactgctggtcagt
gctgaacgtggcatgggcaacagttgtgtggacttggccgcgcatgccggccgcatcatc
acgttggggagccgcacggtgcagttccccgcactggatgactggggtgatgtcctgcga
gcgagcggagtgtgcgcgcgtgtgcctcacacgcaggatgccaacgtgcccctgtttgtg
ctcgaaggcacacgactgtacctgctgcggtatcatcgcgccgaggtgcgtctggccgaa
gccatcgtgcatcgggcgcagcaggccacacccgtggaagcgctgccggacacgccgcga
ttccacgcactgttcccggcggtggatggtgtcgtcgattggcaggcgcgtgcggctgcc
acggctctcgcgtcgccactggtgttcgtgacgggagggcccggcaccggcaagaccacg
gtggcggcgcgcttgctggcactgctgctccatcgtgatcccacgctgacgtttgcgctg
gctgcacccaccgggcgagcggcggcgcggctatccgaggccatcggcgcagcggcgctg
cgtgacgcccttcatgaacttgctccatcgctacctggcgtgtccggcaagacattgcat
cgtctgttgggctaccacacggccacccagcgattccgtcatcatgcacaacggcctctg
gccgaagatgtggtcatcgtcgacgaggccagcatgatcgacgtgctgatgatggatgcg
ctgtttgccgcactcaagccgtccgcgcgtctgatcgtattgggtgatcccgaccaactg
gccagtgtggacacggggttcgtgctgggtgatgtcacgcgggctgcgcacgatgccgtg
aaaagctcggcgatcaggcgctcggtggtgcgactggcatactcctggcgattcggccag
caggtcggcattggcctgctggccgaagccacgcgtgttggcgaaagccagcaggccatg
cgggcgctgcaggacaccgcactgacggatgtcgcatggcaactaccgcatcggagcgcg
caggagctgctggcgccggtggagccgcatgtgcaggcattccttgccactgatacgccg
gtggccgcactcgctgctctggcacgattccgtgtgctctgtgcgctgcgtgatggcccc
ggtggtgtgacggggctcaatgcactgaccgagggttggctgcagcggcagggacgtgct
gtgatgggatggtatgatcatcgaccggtgcttgtcacggccaatgacgcggccacgcag
ctctacaacggtgatgtcggtgtcacgctggccatcgatggtgtgcccatggtgcacttc
ccggcgtctgacggtggggtgcgatccttcatgccatcacaattgccggcccacgagacg
gcatgggcgatgaccgtgcacaaatcacagggatcagaattcgatcatgtgctggtggtg
ctgccggaagcggacagtcgtgtactgacccgcgagttgctctatacggccgtgacccgg
gctcgccgatcagtcaccatcagcggcagtgaccgaatgatcgaagccgcgatccaccga
tcggtggtgcgcggctccggtcttacggatcgattgttggcacaggctggcgcgtcatag

DBGET integrated database retrieval system