KEGG   Gemmatimonas aurantiaca: GAU_3175Help
Entry
GAU_3175          CDS       T00878                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gau03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3753056..3754795)
Genome map
AA seq 579 aa AA seqDB search
MSRLDEAFADLVVRMAAVQAGTTEALLAREVLANTALLVSAERGMGNSCVDLAAHAGRII
TLGSRTVQFPALDDWGDVLRASGVCARVPHTQDANVPLFVLEGTRLYLLRYHRAEVRLAE
AIVHRAQQATPVEALPDTPRFHALFPAVDGVVDWQARAAATALASPLVFVTGGPGTGKTT
VAARLLALLLHRDPTLTFALAAPTGRAAARLSEAIGAAALRDALHELAPSLPGVSGKTLH
RLLGYHTATQRFRHHAQRPLAEDVVIVDEASMIDVLMMDALFAALKPSARLIVLGDPDQL
ASVDTGFVLGDVTRAAHDAVKSSAIRRSVVRLAYSWRFGQQVGIGLLAEATRVGESQQAM
RALQDTALTDVAWQLPHRSAQELLAPVEPHVQAFLATDTPVAALAALARFRVLCALRDGP
GGVTGLNALTEGWLQRQGRAVMGWYDHRPVLVTANDAATQLYNGDVGVTLAIDGVPMVHF
PASDGGVRSFMPSQLPAHETAWAMTVHKSQGSEFDHVLVVLPEADSRVLTRELLYTAVTR
ARRSVTISGSDRMIEAAIHRSVVRGSGLTDRLLAQAGAS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcgtctcgacgaggccttcgccgatctcgtggtgcgtatggccgccgtgcaggcg
ggcaccaccgaagcgctgctggcccgtgaagtgcttgccaataccgcactgctggtcagt
gctgaacgtggcatgggcaacagttgtgtggacttggccgcgcatgccggccgcatcatc
acgttggggagccgcacggtgcagttccccgcactggatgactggggtgatgtcctgcga
gcgagcggagtgtgcgcgcgtgtgcctcacacgcaggatgccaacgtgcccctgtttgtg
ctcgaaggcacacgactgtacctgctgcggtatcatcgcgccgaggtgcgtctggccgaa
gccatcgtgcatcgggcgcagcaggccacacccgtggaagcgctgccggacacgccgcga
ttccacgcactgttcccggcggtggatggtgtcgtcgattggcaggcgcgtgcggctgcc
acggctctcgcgtcgccactggtgttcgtgacgggagggcccggcaccggcaagaccacg
gtggcggcgcgcttgctggcactgctgctccatcgtgatcccacgctgacgtttgcgctg
gctgcacccaccgggcgagcggcggcgcggctatccgaggccatcggcgcagcggcgctg
cgtgacgcccttcatgaacttgctccatcgctacctggcgtgtccggcaagacattgcat
cgtctgttgggctaccacacggccacccagcgattccgtcatcatgcacaacggcctctg
gccgaagatgtggtcatcgtcgacgaggccagcatgatcgacgtgctgatgatggatgcg
ctgtttgccgcactcaagccgtccgcgcgtctgatcgtattgggtgatcccgaccaactg
gccagtgtggacacggggttcgtgctgggtgatgtcacgcgggctgcgcacgatgccgtg
aaaagctcggcgatcaggcgctcggtggtgcgactggcatactcctggcgattcggccag
caggtcggcattggcctgctggccgaagccacgcgtgttggcgaaagccagcaggccatg
cgggcgctgcaggacaccgcactgacggatgtcgcatggcaactaccgcatcggagcgcg
caggagctgctggcgccggtggagccgcatgtgcaggcattccttgccactgatacgccg
gtggccgcactcgctgctctggcacgattccgtgtgctctgtgcgctgcgtgatggcccc
ggtggtgtgacggggctcaatgcactgaccgagggttggctgcagcggcagggacgtgct
gtgatgggatggtatgatcatcgaccggtgcttgtcacggccaatgacgcggccacgcag
ctctacaacggtgatgtcggtgtcacgctggccatcgatggtgtgcccatggtgcacttc
ccggcgtctgacggtggggtgcgatccttcatgccatcacaattgccggcccacgagacg
gcatgggcgatgaccgtgcacaaatcacagggatcagaattcgatcatgtgctggtggtg
ctgccggaagcggacagtcgtgtactgacccgcgagttgctctatacggccgtgacccgg
gctcgccgatcagtcaccatcagcggcagtgaccgaatgatcgaagccgcgatccaccga
tcggtggtgcgcggctccggtcttacggatcgattgttggcacaggctggcgcgtcatag

DBGET integrated database retrieval system