KEGG   Gemmatimonas aurantiaca: GAU_3549Help
Entry
GAU_3549          CDS       T00878                                 

Definition
(GenBank) DapE-ArgE family protein
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00300  Lysine biosynthesis
gau01100  Metabolic pathways
gau01120  Microbial metabolism in diverse environments
gau01230  Biosynthesis of amino acids
Module
gau_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    GAU_3549
Enzymes [BR:gau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     GAU_3549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 SEF14_adhesin
Motif
Other DBs
NCBI-ProteinID: BAH40591
NITE: GAU_3549
UniProt: C1ADL4
Position
complement(4173895..4175178)
Genome map
AA seq 427 aa AA seqDB search
MSNPHAIDRVFAAIDAAEDEMVSFTSEMIRIPTVNPPGDAYVECAEFIGRRLVECDFAVD
YPVAEGRPEHTPQHPRMNVVGLRRGRSDRPLVHLNGHFDVVPAGNGWTVDPFGGEVKNGR
IYGRGTCDMKAGITAAIYAAEAIRRAGVPLHGSVEISGTVDEESGGFAGMAYLAQQGRVS
ADRTDAVIITEPTNTDRIYIGHRGVYWFEVITRGRIAHGSMPFLGANAIEHMGVILDRIR
RVLMPVLQSRTTAVPVKPDGARHATLNINGIAGGQPVDGIQTPCVADICRAIFDRRFLAE
EGFDATRAEIVDLLETAARETPELLFELRDLMIVHPVKTPDGASVVASLERSVQQVLGRP
VLLAASPGTYDHKHVDRIAGVPNCVAYGPGILDLAHQPDEYCDIADLMHSTKVLALSLLE
LTGTTAV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacccgcatgcgatcgatcgagtgttcgccgccattgatgcggctgaggacgag
atggtgtcattcacgtcggagatgattcgcatcccgacggtgaatccccctggcgacgca
tatgtagagtgtgcggagttcatcggacggcggctggtcgaatgcgacttcgccgtcgac
tatccggtggccgaaggacggccggaacacacgccgcagcatccgcgcatgaatgtcgtg
ggtctgcggcgtggtcgttccgacaggccgctggtgcatctcaacgggcacttcgatgtc
gtacctgccggcaacggatggacagtcgatccgttcggtggcgaagtaaagaacggccgc
atctatggacgtggcacctgcgatatgaaagccggcatcacggcggccatctatgcggcg
gaagccattcgccgtgcaggagttccacttcatggatcggtggaaatcagcggcacggtg
gatgaagagagcggggggttcgccggtatggcgtacctcgcgcagcaggggcgtgtcagt
gccgatcgtaccgatgcggtcatcatcacggagccgaccaacaccgaccgcatctacatc
ggtcaccgtggtgtgtattggttcgaggtgatcacgcgcggccgcatcgcacacggttcc
atgccgtttctgggcgccaacgcgatcgagcatatgggcgtaattctcgatcgcatccgg
cgcgtgctcatgccggtgctgcagtctcgcacaacggcggtgccggtgaagcccgatggg
gctcggcacgccacgctcaatatcaatggtatagccggcggccagccggtcgatggtata
cagacgccgtgtgtggcggatatctgccgcgccattttcgatcgccgcttcctcgcggaa
gaaggcttcgacgccacacgcgccgagatcgtggatctgctggaaacggcggctcgggaa
acccccgagctgctcttcgagttgcgtgacctcatgatcgtgcatccggtgaagaccccg
gacggcgcatcggtggtggcgtcgctcgaacgttcagtgcaacaggtgcttggacgtcct
gtgttgctcgcggcaagcccgggcacgtacgaccacaagcacgtcgatcgcatcgcgggt
gtccccaattgtgtggcctatgggccaggcatcctcgacctggcgcaccagccggacgag
tactgcgatatcgccgacctgatgcactccacgaaggtgctcgccctgtccctgctcgag
ctgactggtaccaccgccgtttga

DBGET integrated database retrieval system