KEGG   Gemmatimonadetes bacterium KBS708: J421_0950Help
Entry
J421_0950         CDS       T03025                                 

Definition
Alkaline phosphatase D-related protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
gba  Gemmatimonadetes bacterium KBS708
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:gba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    J421_0950
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    J421_0950
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    J421_0950
Enzymes [BR:gba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     J421_0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
Position
1084490..1086025
Genome map
AA seq 511 aa AA seqDB search
MERRDFLLDLARWAALAAAVPNDWRVTRRPTLADDPFMLGVASGDPTAGGGVLWTKLAPR
PLDPDGGMDGQRVAVGWEVAEDDGFRAIVKQGRATAAPELGYAVHVDVDGLAPGRWYAYR
FTAGGATSPIGRLRTAPASGTVAPLRFAFASCQHYEQGLFTAYGHMAREELDLVAHLGDY
IYEYGAADGRVRRHEGPEVRTIDGYRRRYAQYKSDPLLQAAHARCPWIVTWDDHEVDNNY
AGSVGENEMESEEQMHVRRAAAYQAWWEHQPVRVPRARSWADLTITRTLDWGALARVWVL
DGRQYRSDQPCGDGTKVVPCGEWADPSRTMLGARQERWLYDGLAASRARWQVLANQVMVA
PFDSDPGAPVRLPLDQWSGYPAARDRLLGAIAERAPNRTVVITGDIHSHWVNELRSSFAR
PDRPVVAAEFVGTSITSGGDGGEVTNLPQIQHENPHIKWHANRRGYVACTVDPDAWTAEY
RTVPYVSRPDAPLETPARWRLTRGRAGIDAV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggaacgccgcgacttcctcctcgacctcgcccgctgggccgcgctcgcggcggccgtg
cctaacgactggcgcgtgacgcgccgcccgacgctcgccgacgacccgttcatgctcggc
gtcgcgtcgggcgatccgacggcggggggcggcgtgctgtggacgaagctcgcgccgcgg
ccgctcgatcccgacggcggcatggacgggcagcgcgtcgccgtcggctgggaggtggcg
gaggacgacgggttccgcgcgatcgtgaagcagggacgcgcgacggcggccccggagctg
ggctacgcggtgcacgtcgacgtcgacgggctcgcgccgggccgctggtacgcgtaccgc
ttcaccgccggcggcgcgacgagtcccatcggccggctgcgcacggcgcccgcgtcgggc
acggtcgccccgctccgcttcgcattcgcgtcgtgccagcactacgagcaggggctgttc
accgcgtacggccacatggcgcgcgaggagctcgacctcgtcgcgcacctcggcgactac
atctacgagtacggcgccgccgacggacgcgtacgtcgccacgaggggcccgaggtgcgc
acgatcgacggctaccggcgccgctacgcgcagtacaagagcgacccgctgctgcaggcc
gcgcacgcgcggtgcccgtggatcgtgacgtgggacgaccacgaggtcgacaacaactac
gcgggcagcgtcggcgagaacgagatggagtcggaggagcagatgcacgtgcgccgcgcc
gccgcgtaccaggcgtggtgggagcatcagcccgtgcgcgtgccgcgcgcgcggtcgtgg
gccgacctcacgatcacgcgcacgctcgactggggcgccctcgcgcgcgtgtgggtgctc
gacggtcgccagtaccgcagcgatcagccgtgcggcgacggcacgaaggtcgtgccgtgc
ggcgagtgggccgacccgtcgcgcacgatgctcggcgcgcgccaggaacggtggctgtac
gacggactcgccgcctcgcgcgcgcgatggcaggtgctcgcgaaccaggtgatggtcgcg
ccgttcgacagcgatcccggtgcgccggtgcggctgccgctcgaccagtggagcggctat
cccgcggcgcgcgatcgcctgttgggcgcgatcgccgagcgggcgccgaaccgaacggtg
gtgatcacgggcgacatccactcgcactgggtgaacgagctgcgctcgagcttcgcgcgc
cccgaccgtccggtggtggccgccgagttcgtggggacgagcatcacgtccggcggcgac
ggcggcgaggtgacgaacctgccgcagatccagcacgagaacccgcacatcaagtggcac
gcgaaccggcgcggctacgtggcgtgcacggtggaccccgacgcgtggaccgcggagtac
cgcacggtcccctacgtgagccgccccgacgcgccgctcgagacgccggcgcggtggcgg
ctcacgcgcgggcgggcggggatcgacgctgtttga

DBGET integrated database retrieval system