KEGG   Gemmatimonadetes bacterium KBS708: J421_4060Help
Entry
J421_4060         CDS       T03025                                 

Definition
Phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gba  Gemmatimonadetes bacterium KBS708
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:gba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    J421_4060
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    J421_4060
  Energy metabolism
   00680 Methane metabolism
    J421_4060
Enzymes [BR:gba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     J421_4060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
4696023..4698833
Genome map
AA seq 936 aa AA seqDB search
MPTTESTPAPAPEPTPRPEDLPLHEDVRRLAATLGRVIHRIEGEEAFRTVEDLRRACRAR
RRGDAGALDLDALLDHVDALPLALCALSARAFTLFFLLINTAEQVHRVRRRATYAQHEGG
DAPQVASARWTMRRLRESGRNAAEVARAVERLDVRPVLTAHPTESTRRTLLGLQARVADL
LLRRADASDSERRAIDDALEGEVELLWLTAEVRHDRPSVLDEVSTVLWYLETRLLDASAR
TQDALVRAYEAEFGAASDAVRLAVPLRIGNWVGGDRDGNPFVTPEVTVAAARRASHVILG
RYRDVVDGLIERLSLAAHIAPPPAALLETLESDRAVLPEVWEANRRRNADEPLRLKLTFM
AARLDATRRRVASRDAGRPAHEPAAYDDVAAFERDLQLVRGYLLDAGAAEACRTAFDPLL
ARVRAYGFHGFRMDVRDHADVHAAALDDLAAQVGLGTLDADAMRRELLGRRPLVGPHVPL
ADATRRVLDTFRAVRVVQDESGEPAASTYIVSMATCAEDLLRVLVLAREAGLVDLAADPP
VSRIDTVPLFETLDDLERAPDVLRALFADEVYARQLAARGRRQQVMIGYSDSGKDAGMLA
SSWALYRAQEMLSAVCREHGIDLRLFHGRGGSVGRGGGSPVYRALAALPPGTNEGLIKIT
EQGEIISQQFGLAPIAERTFEVTLSGTLLHAFTDWRDRVDPAEVARFRETMDALAARSLD
LYRDLVHHGDALFALFLTATPVTELAAARFGSRPAYRPGAKPGIEGIRAIPWQFGWTQIR
LMLPGWLGVGSALAELAAKPGGLDVLRRMAEAWPFFDDLLAKIEMVCAKADLEIARAYVE
RLGGDVQLLAELDAEYARTVDALLRIRGTGHLVNDSDVLRAAITLRNPYVDALSLLQITL
LRRKRAAAEGSDERARAEEAVAATLSGIAQGLRNTG
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgacggaatccacaccggccccggcgcccgagccgacgccccgccccgaggac
ctgccgctccacgaggacgtgcgccgcctcgccgcgacgctcggccgcgtcatccatcgc
atcgagggcgaggaggcgttccgcacggtggaggacctgcgccgcgcgtgtcgcgcacgc
cgccgcggcgacgcgggtgcgctcgacctcgacgcgctgctcgaccacgtcgacgcgctg
cctctcgcgctgtgcgcgctctcggcccgcgcgttcacgctgttcttcctgctcatcaac
accgccgagcaagtgcaccgcgtgcggcgacgcgcgacgtacgcgcagcacgagggcggc
gacgcaccgcaggtggcgtccgcgcggtggacgatgcggcggctgcgcgagagcggccgg
aacgccgccgaggtggcgcgcgccgtcgagcggctcgacgtgcgtcccgtgctcacggcg
caccccacggagagcacgcgccgcacgctgctcggcctgcaggcgcgcgtcgccgacctg
ctgctgcgccgcgccgacgcgtcggactccgagcggcgcgcgatcgacgatgcgctcgag
ggcgaggtggagctgctctggctcaccgcggaggtgcgccacgaccgcccgtcggtgctc
gacgaggtgagcacggtgctgtggtacctcgagacgcgcctgctcgacgcgagcgcgcgc
acgcaggacgcgctcgtgcgcgcgtacgaggcggagttcggcgccgcgtcggacgccgtc
aggctcgccgtgccgctgcgcatcggcaactgggtgggcggcgatcgcgacggcaatccg
ttcgtgacgcccgaggtcaccgtcgccgcggcgcgccgcgcgagccacgtcatcctcggc
cgctaccgcgacgtcgtggacgggttgatcgagcggctgtcgctcgccgcgcacatcgcg
ccgccgccggctgcgctgctggagacgctggagagcgacagggcggtgctccccgaggtg
tgggaggcgaaccgccgccgaaacgccgacgagccgctgcggctcaagctcacgttcatg
gccgcccggctcgacgcgacgcggcggcgcgtggcgtcgcgcgacgcgggacggcccgcg
cacgagccggcggcgtacgacgacgtcgcggcgttcgagcgcgacctgcagctcgtgcgc
ggctacctgctcgacgcgggcgcggcggaggcgtgccgcaccgcattcgacccgctgctc
gcgcgcgtgcgcgcgtacggcttccacgggttccgcatggacgtccgcgaccacgccgac
gtgcacgccgcggcgctcgacgacctcgcggcgcaggtcgggttaggcaccctggacgcc
gacgcgatgcggcgcgagctgctcggccggcgtccgctcgtcggaccgcacgtgccgctc
gccgacgcgacccgccgcgtgctcgacacgttccgcgccgtccgcgtcgtgcaggacgag
agcggcgagccggcggcgtccacgtacatcgtgtcgatggcgacgtgcgccgaggatctg
ctgcgcgtgctggtgctcgcgcgcgaggcggggctcgtcgatctcgcggccgatccgccg
gtctcgcgcatcgacaccgtgccgctgttcgagacgctcgacgatctggagcgcgcgccc
gacgtgctgcgcgcgctgttcgccgacgaggtgtacgcgcggcagctcgcggcgcgcggc
cgtcggcagcaggtgatgatcggctactccgactcgggcaaggacgcggggatgctcgcg
tcgtcgtgggcgctgtaccgcgcgcaggagatgctctccgcggtgtgccgcgagcacggc
atcgatctgcggctgttccacggccgcggcgggagcgtgggacgcggcgggggctcgccg
gtgtaccgcgcgctcgccgcgctgccgccaggcacgaacgaaggcctcatcaagatcacc
gagcagggcgagatcatctcgcagcagttcggcctcgcgccgatcgccgagcgcacgttc
gaggtgacgctgagcggcacgctgctgcacgcgttcaccgactggcgcgaccgcgtcgac
ccggccgaggtggcgcgcttccgcgagacgatggacgcgctggccgcgcgatcgctcgac
ctgtaccgcgacctcgtgcatcatggcgacgcgctgttcgcgctgttcctcaccgcgacg
ccggtgaccgagctcgcggccgcgcgcttcggctcgcgtcccgcctaccggccgggcgcg
aagcccggcatcgagggcattcgcgcgatcccgtggcagttcggctggacgcagatccgt
ctcatgctccccggctggctcggcgtcggcagcgcgctcgccgagctcgcggcgaagccg
ggcggcctcgacgtgctgcgccgcatggccgaggcgtggccgttcttcgacgacctgctg
gcgaagatcgagatggtgtgcgcgaaggccgacctcgagatcgcgcgcgcgtacgtggaa
cggttaggcggcgacgtgcagctgctcgccgagctggacgccgagtacgcgcgcacggtc
gacgcgctgctgcgcatccgtggcacgggacacctcgtgaacgactccgacgtgctgcgc
gcggcgatcacgctgcgcaacccgtacgtcgacgcgctgtcgctgctgcagatcacgctg
ctgcgccgcaagcgcgccgccgcggaggggagcgacgagcgtgcgcgcgccgaggaggcc
gtcgcggcgacgctgagcggcatcgcgcaggggctgcgcaacaccggctga

DBGET integrated database retrieval system