KEGG   Gemmatimonadetes bacterium KBS708: J421_4127Help
Entry
J421_4127         CDS       T03025                                 

Definition
alpha amylase catalytic region
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
gba  Gemmatimonadetes bacterium KBS708
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gba00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    J421_4127
Enzymes [BR:gba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     J421_4127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(4796355..4797938)
Genome map
AA seq 527 aa AA seqDB search
MSRGRPTWAAAALLVAVACGGGDGIPAPTGGEAPAVRPALATTYRPSGHAAAGDVFVHLF
EWRWSDVASECEAVLGPAGFRAVQVSPPQEHSITPARDWSERYQPVSYSIDRSRSGTRDE
FVAMVSRCRAAGVDVYVDAVINHMTNFPSPGVGSAGTAYTKYSYPGLYGPSDFHAPCTVT
DYRDAANVQDCELLSLPDLNTGLASVRQQIAGYLVSLSRLGVAGFRIDAAKHIQQVELDG
ILSIVDSTAVAEARPIPYWFLEVSGGAGEALSPRDYFGEAYRSGGAADITEFTFVGVGNK
FRGVNGEHVSQLDPNGAPGGQFSATAWGLMPADKAVVFLQNHDTQHDCGIGYRDAQVFRL
ANVWMLAQPYGYPSVLSSYAFVCPAGNAAGPPSDADGWTLPVRCASSLETATLGQWVCEH
RDPYIRNMVRFRRTVAGTDVTDWWSDGANAIAFSRGDRGFVAINRGAATLAATVRTSVAP
GAYCDLLTGGRSAAGCAGAVVTVAPDGSIALALPPNGAVAIDVTTRR
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtggccgccccacgtgggcggccgccgcgctcctggtcgcggtggcgtgcggc
ggcggcgacggcatccccgcgccgaccggcggcgaggcgcccgccgtccgcccggcgctc
gcgacgacgtaccggccgagcgggcacgcggccgccggcgacgtgttcgtgcacctgttc
gagtggcggtggagcgacgtcgcgtcggagtgcgaggccgttctgggccccgccggcttc
cgcgccgtgcaggtgtcgcccccacaggagcacagcatcaccccggcgcgcgactggagc
gagcgctatcagccggtgagctactcgatcgaccgcagccgctcgggcacgcgcgacgag
ttcgtggccatggtgagccgctgccgcgcggcgggcgtggacgtctacgtcgacgcggtc
atcaatcacatgaccaacttcccgagtcccggcgtcggcagcgcgggcaccgcgtacacg
aagtacagctatccggggctctacggcccgagcgactttcacgcgccgtgcacggtgacc
gactaccgcgacgcggcgaacgtgcaggactgcgagctgctctcgctccccgacctgaac
acgggcctggcgtccgttaggcagcagatcgccggctatctcgtgtcgctctcgcgcctc
ggcgtcgccggcttccgcatcgatgcggcgaagcacatccagcaggtggagctcgacggc
atcctgtcgatcgtcgattccaccgcggtcgccgaggcgcgcccgatcccgtactggttt
ctcgaggtctcgggcggggcgggggaggcgctctcgccacgcgactacttcggcgaggcg
tatcgctccggcggcgccgcggacatcaccgagttcacgttcgtcggcgtcggcaacaag
ttccgcggcgtgaacggcgagcacgtgtcgcagctcgacccgaacggggccccgggtggc
cagttctccgcgaccgcgtggggcctcatgccggcggacaaggccgtggtgttcctgcag
aaccacgacacgcagcacgactgcggcatcggatatcgcgacgcgcaggtcttccggctc
gcgaacgtgtggatgctcgcgcagccgtacgggtatccgtcggtgctctcgagctacgcg
ttcgtctgcccggccgggaacgccgccggcccgccctccgacgccgacgggtggacgctg
cccgtgcgctgcgcgtcgagcctcgagacggcgacgctcggccagtgggtgtgcgagcac
cgtgacccgtacatccgcaacatggtccgcttccgtcgcaccgtcgccggcaccgacgtc
accgactggtggagcgacggcgcgaacgccatcgcgttctcgcgcggcgaccgcggattc
gtggcgatcaaccgcggcgccgcgacgctcgccgcgacggtacgcaccagcgtcgcgccg
ggcgcgtactgcgacctgctcaccggcgggcgctcggccgccgggtgcgcgggcgcggtc
gtgacggtcgcgccggacggatcgatcgcgctcgcgctgccgcctaacggcgcggtggcg
atcgacgtgacgacgcgccgttga

DBGET integrated database retrieval system