KEGG   Granulibacter bethesdensis: GbCGDNIH1_0087Help
Entry
GbCGDNIH1_0087    CDS       T00392                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gbe  Granulibacter bethesdensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gbe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(96436..97089)
Genome map
AA seq 217 aa AA seqDB search
MTDAPSLRPSDLPAEAGMPETTRPSRQEAEQAVRTLLRWACDDPTREGLQETPSRVVRAY
EEWFAGYHDDPVKVLERTFSETEGYDEIILLRGIRIESFCEHHMAPIIGRAHVAYLPRHR
VVGISKLARVVEAFSKRLQIQEKLTAQIANTIDSVLQPHGVAVIVEAAHQCMTTRGVHKT
GVSMVTSRMLGVFRTNPETRRELMAMINNPVQPSALG
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgatgcgccttcgctccgcccctctgatctccctgccgaggcgggcatgccggag
accactcgcccgagccgccaggaagccgaacaggctgtgcgtaccctgctgcgttgggct
tgtgatgatccgacccgcgaaggtcttcaggaaactccctcccgcgtggttcgtgcttat
gaggagtggtttgcaggctatcacgatgatccggtgaaggtgctggaacggacattctcg
gaaaccgagggatatgatgagattatcctgcttcggggtatccgcatcgagagtttctgc
gaacatcacatggctccgatcatcggtcgcgcccatgttgcctatctgccgcgccaccgc
gtcgtgggcatcagcaaactggcacgggtggtggaggctttctccaagcgcctgcaaatt
caggaaaaactgactgcgcagatcgccaatacgatcgactcagtccttcagccgcacggc
gtggccgttatcgtcgaggctgcgcatcaatgcatgacgactcgtggcgtgcacaagacc
ggcgtcagcatggtcaccagccgcatgctgggtgtgttccgcaccaatccagaaacccgg
cgggagttgatggccatgatcaataatccggtccagcccagcgccctaggctga

DBGET integrated database retrieval system