KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_0159Help
Entry
GbCGDNIH1_0159    CDS       T00392                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    GbCGDNIH1_0159
Enzymes [BR:gbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     GbCGDNIH1_0159
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     GbCGDNIH1_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
181232..182134
Genome map
AA seq 300 aa AA seqDB search
MKQGMRFMPELPEVETVMRGLRARLEGRRIVRAEVRRPDLRFPLPPGLAARLTGAYVRDF
RRRGKYILMRLDGGDSLLIHLGMSGRFVLRAPADTTLPEGHEPERHEHVSMMAEDGWIAA
LVDPRRFGMMDLVPTAAEDAHRLLSSMGPEPLEDAFCLSGLEKAFAGRRTAVKLALLDQR
IVAGLGNIYVSEALFRAGINPLRAAGDLSRAELRRLIPAIRETLTEAIAAGGSSLRDYVQ
PDGELGYFQHAWKVYGRAGQPCEHCPGLSAGCQGIVQIVQGGRSTYFCPCTQQQAGKQAG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaaggaatgcgcttcatgccggaactgccggaagttgaaacggtgatgcgtggc
ctgcgtgcgcgtctggaggggcgtcgtatcgtgcgggcggaggtcaggcggcctgatctg
cgctttcctctgccacccggtctggcggcccggctgacgggtgcgtatgtgcgggatttc
cgtcggcgtggaaaatacatcctgatgcgtctggatggcggtgacagcctgttgattcac
ctgggcatgtccggtcgtttcgtgctgcgtgcacccgccgacacgaccttgccggagggg
catgaaccggagcggcatgaacacgtctccatgatggctgaggatggctggatcgcggcg
ctggtcgacccgaggcggttcggcatgatggatctggtgccgactgcggcggaggatgcg
catcgtctgctctcctccatggggcctgagccgctggaagatgcattttgtctctctggt
ctggaaaaggcatttgccggtcgccgcacggcggtgaaactggctctgctggatcaacgg
atcgtggccgggctgggcaatatctatgtttcggaggccctgttccgggccgggatcaat
ccgctgcgggccgcgggggacctctcccgggctgaactccggcggttgatccccgcgatt
cgcgagacgttgacggaagcgattgccgcaggtggctcctccctgcgtgactatgtgcag
ccggatggtgaactgggctatttccagcatgcatggaaagtctatggccgtgcggggcag
ccttgcgaacattgtcccggcctgtccgccggctgtcaggggatcgtccagatcgtgcag
ggcggtcgaagcacgtatttctgtccctgtacccagcaacaggcggggaaacaggcggga
tga

DBGET integrated database retrieval system