KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_0259Help
Entry
GbCGDNIH1_0259    CDS       T00392                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GbCGDNIH1_0259 (recR)
DNA repair and recombination proteins [BR:gbe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      GbCGDNIH1_0259 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(303989..304597)
Genome map
AA seq 202 aa AA seqDB search
MGGPELEQLIALLARLPGLGPRSARRAALRLLQQPETRLLPLAAAMQNAARAVKTCRVCG
NLDSADPCSVCTDPSRENGLICVVESVGDLWAMDRAGIYRGLYHVLGGVLSALAGTGPDA
LNWPALMRRIESSRPSATPVTEVILALGATVDGATTAHWLAEQLRPMGVSVTRLAQGIPI
GGALDVLDDGTLAAAMRARRSA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgggcggaccggaactggagcaactgatcgccttactggcccgactgcccggactgggt
ccgcgcagcgcccgccgtgccgccctgcgcctgttgcagcagccggagacccggctgttg
ccccttgccgccgccatgcagaacgctgcccgcgccgtcaaaacctgccgggtctgcggc
aatctggacagcgccgatccatgctctgtctgcactgacccaagccgggaaaatggactg
atctgcgtcgtcgaaagcgtcggcgatctgtgggccatggatcgggcggggatctatcgc
gggctgtaccatgtgctgggcggggtgctgtccgctctggccgggaccggtccggatgcc
ctcaactggcccgcgctcatgcggcgtatcgagtcttcccgcccatccgcaaccccggtc
acagaagtcattcttgccctgggtgccaccgttgatggggccacaaccgcacattggctg
gccgagcaactgcgaccaatgggggtttccgtcacccggctggcacaggggattcccatt
ggcggcgcgctggatgttctggatgacggtacccttgctgccgctatgcgggcaaggcgg
tctgcatga

DBGET integrated database retrieval system