KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_0265Help
Entry
GbCGDNIH1_0265    CDS       T00392                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
gbe00010  Glycolysis / Gluconeogenesis
gbe00620  Pyruvate metabolism
gbe00640  Propanoate metabolism
gbe00680  Methane metabolism
gbe01100  Metabolic pathways
gbe01110  Biosynthesis of secondary metabolites
gbe01120  Microbial metabolism in diverse environments
gbe01130  Biosynthesis of antibiotics
gbe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GbCGDNIH1_0265
   00620 Pyruvate metabolism
    GbCGDNIH1_0265
   00640 Propanoate metabolism
    GbCGDNIH1_0265
  Energy metabolism
   00680 Methane metabolism
    GbCGDNIH1_0265
Enzymes [BR:gbe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GbCGDNIH1_0265
Lipid biosynthesis proteins [BR:gbe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GbCGDNIH1_0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABI61163
UniProt: Q0BVI9
Position
complement(309767..311701)
Genome map
AA seq 644 aa AA seqDB search
MSEPTLIHVKPSLADSAHVNARRHSLMTHQAGTDPDAFWAEEARRIPWFREPTLIKSTSF
EGDVSIRWFEDGRLNASVACLDQHLETRGDQSAILWEGDEPGTQGSLTYRQLHDRVCRLA
NVMKSMGIGRGDRVTIYLPMVIEAAIAMLACARIGAVHAVVFGGFSPDSLADRIRDSESS
LLITADEGRRGGRKVPLKRNADEALSRVDCIRNVIVVTVTGGDVNMQAGRDQRYETLIEA
ASPDCPPEEMNAEDPLFILYTSGSTGTPKGVLHTTGGYMVWASFTHELVFDYHAPEVYWC
TADVGWITGHTYIVYGPLANGATTLMFEGVPNYPDSSRFWQVVDKYNVSIFYTAPTAIRA
LMREGDAPVKKTSRKSLRILGTVGEPINPEAWRWYYEVVGEERCPVIDTWWQTETGGHLI
TPLPGAIAQKPGSATLPLPGVKAVLVDNEGNVLEGEAEGSLCIADSWPGQMRTLYGDHER
FVQTYFSTYKGLYFTGDGARRDADGYFWITGRIDDVLNVSGHRLGTAEVESALVAHGDVA
EAAVVGVPHDIKGQGIYAFVTLKDGYEPSDTLRSELINWVRRQIGPIATPDVIQWAPGLP
KTRSGKIMRRILRKIACNETDGLGDISTLADPSVVEDLIANRPA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagccgaccctgattcatgtgaagccgtctcttgcggattcggcccatgtgaat
gcccgccgtcacagcctgatgactcatcaggccggaacggatcccgatgctttctgggcc
gaagaagccaggcgcatcccgtggttccgggaaccgaccctgatcaaaagcacgtccttc
gagggtgatgtctcgatccgctggttcgaggatggccgcctgaacgcttctgtcgcctgt
ctggatcagcatctggaaacgcgcggcgatcagagcgcgattctgtgggaaggcgatgaa
cccggaacacagggcagcctgacctatcgccagttgcatgaccgcgtctgccgtctggcg
aatgtcatgaaatccatgggcatcgggcgaggtgatcgcgttacgatctacctgccgatg
gtgatagaagccgccattgcgatgctggcctgcgcccgtatcggcgcggtgcatgctgtg
gtgttcggcggcttttcccccgacagccttgccgaccgtatccgtgacagcgaatccagc
ctgctcatcaccgccgatgaaggtcgccggggcggacggaaagtgccgctgaagcgcaat
gccgatgaggccctgtccagggttgactgcatccggaacgtgattgtcgtcaccgtcacc
ggcggcgatgtcaacatgcaggcagggcgcgatcaacgatacgaaaccctgatcgaggca
gcctcccccgactgtccgccagaggaaatgaacgccgaagatcctctgttcattctctat
acctccggcagcaccggcacgccgaaaggcgtcctgcataccaccggcggctatatggtc
tgggccagcttcacgcatgagctggtgttcgactaccacgcccccgaagtatactggtgc
accgcggatgtgggctggatcaccggccatacctatatcgtgtacggaccgctggcgaat
ggcgcgaccacgctgatgttcgagggcgtgccgaactacccggacagcagccgtttctgg
caggtggtcgacaaatacaacgtttcgatcttctacaccgcgccgaccgcaatccgtgcg
ctgatgcgggaaggcgatgcaccggtcaaaaagacctcccgcaaatccctgcgcattctc
ggcacggtgggcgagccgatcaatccggaagcatggcgctggtattacgaggtcgtcggc
gaagaacgctgcccggtgatcgacacatggtggcagacggaaaccggcggtcatctgatc
acgccgctgcccggcgcgatcgcccagaaacccggcagtgccaccctgccactccccggc
gtcaaggcggttctggtcgataacgaaggcaatgtgctggagggcgaagccgaaggcagt
ctctgcatcgccgatagctggccgggccagatgaggacgctgtatggcgatcatgaacgg
ttcgtgcagacctatttctccacctacaaaggcctgtatttcaccggcgacggcgcccgt
cgcgatgcagatggctatttctggatcaccgggcgtatcgacgatgtgctgaacgtctcc
ggccaccgtctcggcacggccgaggtggaaagcgcactggttgcgcatggcgatgttgcc
gaagccgccgtggtcggtgttccgcacgacatcaagggtcagggaatctatgcgttcgtc
accctgaaggacgggtacgaacccagcgacacactgcgcagcgagctgatcaactgggtc
cggcggcagatcgggccgatcgccacgccggatgtgatccagtgggcacccggactgccg
aaaacccgcagcggcaagatcatgcgccggattctgcgtaagatcgcctgcaatgaaacc
gatgggctgggggatatctcaaccctggccgatccctcggtggtggaagatctgattgcc
aatcgcccggcctga

DBGET integrated database retrieval system