KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_0486Help
Entry
GbCGDNIH1_0486    CDS       T00392                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GbCGDNIH1_0486
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GbCGDNIH1_0486
Enzymes [BR:gbe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     GbCGDNIH1_0486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(547220..548575)
Genome map
AA seq 451 aa AA seqDB search
MPNVAQLRAEGVIIMRHMASICFAPDGAGSVPFDMEERFAGVKRDYTQADVEKLAGSFRV
KHTIAEMGAKRLWTLLRNEPFVNTLGALTGNQAVQQVKAGLKAIYLSGWQVAADANLAGE
MYPDQSLYPANSVPAVVRRINNALRRSDQIAHMEGAKAGRDGDIHWMAPIVADAEAGFGG
ALNSYELMKAMIDAGAAGVHFEDQLASEKKCGHLGGKVLVPISQHIRTLNAARLAADVEG
VPTVLLCRTDSHAAQLLTTNVDERDHPFISGERTPEGFYRIKEGVGVDYAIARSLAYAPY
ADLLWWETSEPNLEEAEQFANAIAKQFPGKMLAYNCSPSFNWKKKLPPEKIAEFQRAIGS
MGYKFQFVTLAGFHSLNYSMFQLARGYKDRGMAAYSELQQAEFSAEADGYTATRHQREVG
VSYFDAISMAVSQGQSSTTAFAGSTEEEQFH
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgccaaatgttgcgcagttaagagccgagggagtaataattatgcgtcacatggcctcc
atctgtttcgcgccggacggcgccggcagcgttcccttcgatatggaagaacgcttcgcc
ggcgttaagcgcgactatacccaggccgatgtggagaagctggctggcagcttccgcgtc
aagcacaccattgccgaaatgggcgcgaagcgtctgtggacgctgctgcgtaacgagccg
ttcgtgaacacgctgggcgccctgaccggcaaccaggcggttcagcaggtcaaggccggc
ctgaaggccatctacctgtccggctggcaggtcgccgccgatgccaacctggccggtgaa
atgtatcccgaccagtccttgtatcccgcgaactcggttccggccgttgtccgccgcatc
aacaacgcgctgcgtcgctccgaccagatcgcccacatggaaggcgccaaggccggccgt
gatggcgacattcactggatggccccgatcgtggccgatgccgaagcaggcttcggtggc
gcgctgaattcctacgagctgatgaaggccatgatcgatgcgggcgccgccggcgttcac
ttcgaagaccagcttgcttccgaaaagaagtgcggccatctgggtggcaaggttctggtg
ccgatcagccagcacatccgcaccctgaacgcagcccgtctggccgccgatgtcgaaggc
gttccgaccgttctgctgtgccgcaccgacagccatgccgcacagctgctgaccaccaat
gtcgatgagcgcgaccatccgttcatcagcggtgagcgcaccccggaaggcttctatcgc
atcaaggaaggcgtgggcgtcgattacgcgatcgctcgctccctggcttatgcgccgtat
gccgacctgctgtggtgggaaaccagcgagccgaacctggaagaagccgagcagttcgcc
aacgcgatcgccaagcagttcccgggcaagatgctggcctacaactgctcccccagcttc
aactggaagaagaagctcccgccggagaagatcgccgaattccagcgcgcgatcggctcc
atgggttacaagttccagttcgtcacgctggcgggcttccacagcctgaactactccatg
ttccagctggcccgtggctacaaggatcgtggcatggctgcgtattccgagctgcagcag
gccgagttctccgccgaggccgatggctacaccgccacccgccatcagcgcgaagtgggc
gtgtcttacttcgacgcgatctccatggcagtgtctcagggtcagtcttccaccactgcc
ttcgccggcagcacggaagaagagcagttccactaa

DBGET integrated database retrieval system