KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_0589Help
Entry
GbCGDNIH1_0589    CDS       T00392                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GbCGDNIH1_0589
   00052 Galactose metabolism
    GbCGDNIH1_0589
   00500 Starch and sucrose metabolism
    GbCGDNIH1_0589
   00520 Amino sugar and nucleotide sugar metabolism
    GbCGDNIH1_0589
Enzymes [BR:gbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GbCGDNIH1_0589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
663942..664811
Genome map
AA seq 289 aa AA seqDB search
MNKPLRKAVLPVAGLGTRFLPATKATAKEMLPVVDKPLIQYAVDEARAAGIEQFCMVTGR
GKTAIVEHFDVAYELESTLRERNKDDALKLLEDTQLLPGSIVTVRQQEPLGLGHAIWCAR
AFIGEDPFAILLPDDLVLSETPCLKQLADAYQETGGNVVAVAEVPREQTNRYGILKTGED
DGRMVEVTGLVEKPKPEEAPSNLSIIGRYVLRPEVIAELARMERGAGNEVQLTDAMARLI
GRMPFHGLRYEGRRFDCGDKAGFLEAQIAFALKRPDLAPAVRAFLKDYV
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaccgttgcgcaaggcggttttaccggtggccggattaggcacccggtttttg
cccgccacaaaggcaacggcgaaggaaatgctgcccgttgtcgacaaaccgctgattcaa
tatgcggtggacgaggcgagggccgccgggatcgagcagttctgcatggtcaccggccgt
ggcaagacagccatcgttgagcatttcgatgtcgcatatgagcttgagtctacattgcgg
gagcgcaacaaggatgatgcgctgaaattgctggaagatacccagcttctgcccggctcc
atcgtcacggtgcgccagcaggagccgttgggtctgggccatgcgatctggtgtgcgcgt
gccttcatcggggaggatccgttcgctatccttttgcccgatgatctggtcctgtccgag
acgccctgcctgaagcagttggccgacgcctatcaggaaaccggcggtaacgtggttgcc
gtggcggaagtgccgagagagcagaccaaccgctacggtattctcaagactggcgaggat
gatggccgcatggtcgaggtgaccggcctggtcgagaagccgaagccggaggaagcgcca
tccaacctctccatcatcggtcgctatgtgctgcgcccggaggtaattgccgagctggcg
cggatggagcgcggggctggtaatgaggtgcaattgactgatgctatggcgcgtctgatc
ggccggatgccgttccatggcctgcgttatgagggacgccgtttcgattgcggcgacaag
gcaggattcctggaagcacagatcgcttttgcgttgaagcgcccagaccttgcgccggca
gtcagggcgttcctgaaagactacgtgtaa

DBGET integrated database retrieval system