KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_0748Help
Entry
GbCGDNIH1_0748    CDS       T00392                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GbCGDNIH1_0748
Enzymes [BR:gbe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     GbCGDNIH1_0748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(857996..860008)
Genome map
AA seq 670 aa AA seqDB search
MIDEDLHRLADRAGVSTWYRDAFGHDNAVSPDTLRAVLRAIGLPGDSPGQIADSLAILQA
REDGRHLPPLMTADAGQPISLGQQEGAWELTLENGTRRSGTLNPGESLPPIEEPGYHSLE
IAGQRITIANAPAECKRPRHGSWGVAAQLYALRREGDGGIGDFAALARFAPAAARQGAHA
IGISPVHAQFSADPDRFSPYSPSSRIALNVLHGDDAGLLDGFSFPEGEAERQHLESLSLI
DWPAATRLRLRRYRALFDALGGTHPDFTAWRAGPGKMVEDHARFEALHGHFFGTDPSRWN
WRSWPEEYRHPASLTVQRFAVEHAKEVDFHAFLQFLAERGLAHAQHAARESGMEIGLITD
LAVGTDGGGSHCWSRQKETLIGLSVGAPPDLLSPQGQDWGLTAFSPVGLMEQGFSAFIEM
LRAALRHAGGVRIDHVMGIARLWVLPEGARATEGAYLRFPLQDMLRLIALESHAHQALVL
GEDLGTVPEGFSDALQARAVHGLRVLYFERGEHGFKPPEYYSRTAVAMTSTHDLAPVAGW
WSGHDLETRKSLGLLGDDTAIWLSYEERERDRQALWGAMQASGAAQGDAPEAHNTSPAVD
AAIRHIGRTNSTLVLLPIEDALGLREQPNLPGTYREHPNWRRRFNGAAEALFDSPDVSHR
LQELEKSRPS
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
gtgattgatgaagacctccatcgccttgccgaccgtgccggagtatctacctggtacaga
gatgctttcggacatgataatgccgtctccccggatacattgcgggccgtattgcgggca
ataggactgcccggcgacagtccgggccagattgcggacagcctcgccattcttcaggca
cgggaagacgggcggcatcttcctcccctgatgaccgccgatgcggggcagcccatttcg
ctcgggcagcaggaaggcgcgtgggaactgacgctggagaacggcacacgccgcagcgga
acactcaatcctggcgaaagcctgccacccattgaagaacccggttatcacagtctggaa
atagccggacagcgcatcactattgccaatgctccggccgagtgcaaacgcccccgtcat
ggaagctggggggtggcagcacagctttatgccctccgccgcgaaggagatgggggcatt
ggtgatttcgccgcgctggcccgctttgctcccgccgccgcacggcagggtgcgcacgcg
atcggcatcagtccggtccatgcccagttcagcgccgatccggaccgattcagcccgtat
tctccctccagccgtattgcgctcaatgtgctgcatggcgacgatgccggtcttctggac
ggtttttccttcccggaaggagaggccgagcgccagcatctggaaagcctcagcctgatt
gactggcctgccgccacgcgtctgcgtctgcgccgctatcgcgccctgttcgatgcgctg
ggcggcacccatcccgacttcaccgcatggcgggccggtcctggcaaaatggtggaggac
cacgcccgttttgaagccctgcacgggcatttcttcggaaccgacccgtcccgctggaac
tggcggagctggccggaggagtatcgtcaccctgcctccctcaccgtacagcgttttgca
gtcgagcatgcaaaagaagtcgatttccatgccttcctgcaatttctggccgagcgtggg
ctggctcatgcccagcatgctgcgcgggaaagcgggatggagatcgggctgatcaccgat
ctcgccgtcggcacggatggaggcggcagtcattgctggagccggcagaaagaaacgctg
atcggcctgtccgtaggcgcaccccccgatctgctcagtccgcaggggcaggattggggc
ctgacggctttctcccccgtcggtctgatggagcaaggattcagcgctttcattgaaatg
ctgcgcgccgccctgcgccatgcgggcggggtacggatcgatcatgtgatgggtattgcc
cggctttgggtgttgccggaaggcgcgcgcgcgaccgaaggcgcttatctgcgctttccg
ttgcaggatatgctgcgcctgatcgcgctggaaagccatgcgcatcaggcattggtcctg
ggcgaggatctggggaccgtaccggaagggtttagtgacgcgcttcaggcccgtgccgta
catggattgcgtgtgctgtatttcgagcgcggagaacatggcttcaaaccgcctgaatat
tattcccgcaccgccgtcgccatgaccagcacgcacgaccttgcccccgttgcggggtgg
tggagcggccatgatctggaaacccggaagtcactcggcttgctgggtgacgacacggct
atctggctcagttacgaagaacgcgagcgtgacagacaagccctgtggggtgccatgcag
gcatcgggcgcggctcaaggcgatgcgcccgaggcacataataccagccctgccgtggat
gcagcgatccgtcatatcggccgtacgaactcgaccctcgtgctgttgccgatagaagat
gcgctcggattacgcgaacagccgaatcttccggggacttacagggaacatccgaactgg
cgccgtcgtttcaatggagcagcggaagcattgttcgactccccggacgtgtcgcatcgc
ttgcaggaattggaaaaaagccgcccctcatga

DBGET integrated database retrieval system