KEGG   Granulibacter bethesdensis: GbCGDNIH1_0765Help
Entry
GbCGDNIH1_0765    CDS       T00392                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
gbe  Granulibacter bethesdensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gbe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
881927..883405
Genome map
AA seq 492 aa AA seqDB search
MADASAEHIVFLTGHLAEARLRDVLQGLGQTPFTWEVANVGVKVAALMTGAIVQRRLKTP
IQADRVIFPGRAGIDPDEMQAHFGVHFERGPEELADLPRFLGRKGGPPDLSKHDLRIFAE
IVTAIDLSPDAIVERARWLAADGADVIDVGCKPGRHFAHLEDQIRALKQAGFKVSVDSGD
PEELRRGALAGADFLLSLNEDTLDVVDGTAAVPVLLSKPHGDLDSLVRAARKADAKGIDY
MLDPVLDPINFGFTDSLMRYVRIREMLPKAEIMMGTGNLTELTDADTSGITATLVGICTE
LRIRNVLIVHVSPHTRRTVAEHDVARRMMFAARAHAELPRNYTSALLHVHDRWPYAQSSE
DIAGLASEIRDSNFRIAVAEDGIHVFNGALHQVSDTAFPFFPHLGVEQDGAHGFYLGAEL
MKAEIAYALGKRYTQDEPLDWGCAVRPGAATDRTRLADAGHTLKSKQEREERKRASDTAP
DASPPTGQDDIP
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgcctctgccgaacacatcgtttttttgaccgggcatctggcggaagccaga
ttgcgcgatgtgctgcaagggctggggcagaccccttttacctgggaggtggccaatgtc
ggtgtgaaggtcgcggcattgatgaccggagccatcgtgcagcgtcgtctgaaaacgccg
atacaggcagatcgggttatctttcctggccgggccgggatcgatccggatgaaatgcag
gcccatttcggggtgcatttcgaacgggggccggaggaactggccgatcttccccgtttt
ctgggacggaaaggtggtcctcctgatttatccaagcatgatctgagaattttcgcggag
atcgtcacggcgattgatctttccccggatgcgattgtcgagcgggcgcgctggcttgcc
gcggatggggcggatgtcattgatgtcggctgtaagccgggacgtcatttcgcgcatctg
gaagaccagatccgtgccttgaaacaagctggtttcaaggtcagcgtggatagcggcgat
cctgaggaattgcggcgtggcgcgctggctggagcggattttctgctgagcctgaatgaa
gatacgctggatgtggttgatggcactgcggcggtgcctgtgctgctgtccaaaccacat
ggtgatctcgacagtttggtccgggcggccagaaaagcggatgccaagggcatcgactat
atgctggatccggtgctcgatccgatcaatttcggctttacggattcactgatgcggtat
gtgcggatcagggaaatgctgccgaaggctgaaatcatgatgggcaccggtaatctgacc
gagctgaccgatgccgatacatccggcatcacggccactctggtcggcatctgcaccgag
ctgcgtattcgtaatgtgctgatcgtgcatgtcagcccgcatacacgtcgcacggtagcg
gaacatgatgtcgcgcgccgtatgatgttcgcagcccgtgcccatgcggagttgccacgc
aattataccagtgccttgctgcatgttcatgatcgctggccttatgcgcagtcatcggaa
gacattgccggtcttgccagtgaaatacgcgattccaatttccggattgccgtggcggaa
gacggtattcacgtttttaacggcgcattgcatcaggtttcggacacggcttttcctttc
ttcccccatcttggggtagagcaggatggcgcgcatggattttatctcggcgctgaattg
atgaaggcggaaatcgcctacgccctcggcaaacgatacacgcaggacgagccactggat
tggggctgtgccgtgcgtccgggggcagccacggatcgcacgcgtcttgcggatgccggg
catacgctgaaatcgaagcaggagagggaagagcggaaacgtgcatccgacacggcacca
gatgcttccccgccgaccgggcaggatgacattccatga

DBGET integrated database retrieval system