KEGG   Granulibacter bethesdensis: GbCGDNIH1_0809Help
Entry
GbCGDNIH1_0809    CDS       T00392                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
gbe  Granulibacter bethesdensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:gbe00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gbe00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(933509..934459)
Genome map
AA seq 316 aa AA seqDB search
MDFVRPHLLAIEGLHPPEIHALLDLAESYALLNRSGKTQRDLLRGRTLINLFFEDSTRTR
TSFELAGKRLGADVINMSVSTSSVNKGETLLDTASTLNAMHCDLLVVRHSQSGAPNLLAQ
KVDAAVINAGDGTHEHPTQALLDALTIRRHKGRLEGLTVAICGDVLHSRVARSNIYLLAS
LGSQVRLIGPPTLIPGAADRLGVEVFHDMDRGLDGADVVMMLRLQRERMKSGLVPSEREY
FRFFGLNEARLAKAKPDAIIMHPGPMNRGVEIESRVADDPVRSVIKEQVEMGVAVRMAVL
DALARQRSRLPSSRPV
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
ttggatttcgtcagaccccacctcctcgctattgagggactgcacccgcccgagattcat
gctttgctggatctggcggagagctatgctctgctcaaccgctccggcaagacgcagcgg
gatctgctgcgcggtcgtacgctgatcaatctgttcttcgaggacagcacccgcacccgc
accagtttcgagctcgccggcaagcggctgggggcagacgtcatcaacatgtcggtctcc
accagcagcgtgaacaagggggagacgctgctcgacacggcctctaccctcaatgcgatg
cactgcgatctgctggtcgtacggcacagccaatccggcgcgcctaatctgctggcgcag
aaagtggatgctgccgtgatcaatgccggggacggcacgcatgagcatccaacacaagca
ttgctggatgcattgaccatccgccgtcacaagggccgcctggaaggactgaccgtggcg
atctgcggcgatgtgctgcattcccgcgtagcacgctccaacatctatctgctggcctcg
ctgggcagtcaggtgcgtctgatcgggccgcctaccctgataccgggcgccgctgatcgt
ctgggggtcgaagtctttcacgatatggatcgcgggctggatggcgcggatgtggtcatg
atgctgcggcttcagcgggagcgcatgaaaagcggtctggtgcccagcgagcgtgagtat
ttccgcttcttcggcctcaacgaggcccggttggcgaaagcgaaaccggatgccatcatc
atgcatcccggcccgatgaatcgcggtgtcgaaatcgaaagccgcgttgccgatgatccg
gtgcgcagtgtcatcaaggaacaggtggaaatgggtgtcgccgtgcgcatggccgtgctg
gacgcgctggcccggcaaaggagccgcctgccttcctcccgcccggtctga

DBGET integrated database retrieval system