KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_0819Help
Entry
GbCGDNIH1_0819    CDS       T00392                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
gbe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gbe01100  Metabolic pathways
gbe01110  Biosynthesis of secondary metabolites
gbe01130  Biosynthesis of antibiotics
gbe01230  Biosynthesis of amino acids
Module
gbe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GbCGDNIH1_0819
Enzymes [BR:gbe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GbCGDNIH1_0819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABI61717
UniProt: Q0BTY5
Position
complement(945661..946578)
Genome map
AA seq 305 aa AA seqDB search
MPVTTFGAMMTTLPASQPDQTTPAETGAATPTGYDVLARICADTRKEVAQRKALLSKETL
INRIRDLPAPRGFGQALKDAVLQGGYGLITEIKKASPSGGLIRPNFNPAELAKAYQVGGA
TCLSVLTDGPYFQGDPDHLVAARAAVSLPVLRKDFILDPWQIYESRAMGADCILLIMAAL
TDDEARELEETARHLDLDVLAEVHDEAELDRALALQTGLIGINNRNLKTLKTDLSTTLNI
APLLPPDRFLVAESGIRTHEDIQRLAATGVRSFLVGESLMRQQDVTKAVRELIGIDASSS
VPPIA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtgactactttcggagccatgatgacaacacttcccgcctcacagccggatcag
accacgccagccgaaaccggggccgccacgcccaccggttacgatgtgctggcccgtatc
tgcgccgatacccgcaaggaagtggcgcaacgcaaagcgttgctttccaaagaaacgttg
atcaaccgtattcgtgatctgcctgccccccgtggcttcgggcaggcactgaaggatgcc
gtgcttcagggtggctatggtctgatcaccgagatcaagaaagcatctccctccggcggg
ttgatacgcccgaatttcaatccggccgaactggccaaagcctatcaggtcgggggcgcg
acctgtctgtccgtgctgaccgatggaccgtattttcagggtgatccggaccatctggtc
gctgcgcgtgccgccgtgtccctgccggtactgcgcaaggattttatcctcgatccctgg
cagatctatgaaagccgcgccatgggggcggattgcatcctgctgatcatggccgcactg
accgatgacgaagcacgggaactggaagaaacagcccgtcatcttgatctggacgtgctg
gctgaagtccatgacgaagccgaactcgatcgtgcactggcccttcagacgggactgatc
ggcatcaataaccgcaatctgaaaaccctgaaaacagacctctccaccaccctgaacatc
gcgcctttgcttccgcccgaccggtttctggtcgcggaaagcggcatccgcacgcatgaa
gacatacagcgcctggcggcaacaggcgtacgcagctttctggtcggcgaaagcctgatg
cggcagcaggatgtcaccaaggccgtgcgtgagctgataggcatcgatgcttcatcttct
gtcccgcccattgcctga

DBGET integrated database retrieval system