KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_0826Help
Entry
GbCGDNIH1_0826    CDS       T00392                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GbCGDNIH1_0826
   01230 Biosynthesis of amino acids
    GbCGDNIH1_0826
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GbCGDNIH1_0826
   00051 Fructose and mannose metabolism
    GbCGDNIH1_0826
   00562 Inositol phosphate metabolism
    GbCGDNIH1_0826
Enzymes [BR:gbe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GbCGDNIH1_0826
Exosome [BR:gbe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GbCGDNIH1_0826
  Exosomal proteins of bladder cancer cells
   GbCGDNIH1_0826
  Exosomal proteins of melanoma cells
   GbCGDNIH1_0826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
954226..954975
Genome map
AA seq 249 aa AA seqDB search
MRQLIAGNWKMNGLRSTSESLLQALRDAAPHALRNCDMLICPPATLIAQAASVLAGSGIE
VGAQDCHMARSGAHTGDLSAEMLVEAGAHWVILGHSERRRDHGELSETVREKVIAARQFG
LTPIVCVGETEDERASGRETEIVGWQIKGSLPDGFAADSNGVIAYEPVWAIGTGRTATVE
DVAMMHAFIREELVRQFGEAGRGVRILYGGSVKPENAASLLRVPEVGGALVGGASLSAQD
FLAIAEASA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgccagctgattgccggaaactggaaaatgaacgggctgcgcagtacgtcggagtcg
ttgttgcaggccctgcgggatgcggctcctcacgcgctgcggaattgcgacatgctgatc
tgcccgcctgcgacactgattgcacaggcggcatcggttctggccggtagcgggattgag
gtcggggcgcaggattgtcatatggcccgctccggcgcgcatacgggcgatctgtctgcg
gaaatgctggttgaggcaggcgcgcactgggtgattctgggtcattccgagcgccgccgc
gatcatggtgaattgagcgaaacggtgcgtgagaaagtcatcgcagctcgtcagttcggt
ctgaccccgattgtctgtgtcggtgaaacggaggatgagcgtgcctccggccgggaaacg
gagattgttggctggcagatcaagggcagcctgccggacgggtttgcagcggactcgaat
ggcgttatcgcctacgagccggtctgggccatcggtaccgggcgcacagcgacggtagag
gatgtggccatgatgcatgccttcatccgggaggaactggttcgccagtttggagaagcc
gggcggggcgtccggattttatatggcggctcggtcaagccggagaatgcggccagcctg
ctgcgcgtgccggaggttggtggtgcgctggtcgggggggcgagcctgtcggcacaggat
tttctggccattgctgaggcttctgcctga

DBGET integrated database retrieval system