KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_0980Help
Entry
GbCGDNIH1_0980    CDS       T00392                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
gbe00010  Glycolysis / Gluconeogenesis
gbe00052  Galactose metabolism
gbe00500  Starch and sucrose metabolism
gbe00520  Amino sugar and nucleotide sugar metabolism
gbe00521  Streptomycin biosynthesis
gbe01100  Metabolic pathways
gbe01110  Biosynthesis of secondary metabolites
gbe01120  Microbial metabolism in diverse environments
gbe01130  Biosynthesis of antibiotics
gbe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GbCGDNIH1_0980
   00052 Galactose metabolism
    GbCGDNIH1_0980
   00500 Starch and sucrose metabolism
    GbCGDNIH1_0980
   00520 Amino sugar and nucleotide sugar metabolism
    GbCGDNIH1_0980
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GbCGDNIH1_0980
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GbCGDNIH1_0980
Enzymes [BR:gbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GbCGDNIH1_0980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ABI61878
UniProt: Q0BTH4
Position
1116577..1117632
Genome map
AA seq 351 aa AA seqDB search
MFYIRFFNNPMLVVLASKQSDTGHSSSRVDHIMTEFPPRLIGDIGGTNVRFALAMGEGVI
VHEHKLPVAEFDSLELAARTYLQARGSLSQEVEEAVFAVATPVKGDEIAFTNNPWRFSIR
STEAALGLKRLEIINDFVAQAASIRVTPDEEMTIIKSGEVMEHHPAVVIGPGTGLGMAFI
LRRKDGEEILASEGGHCTFSPRDETQTFIRDQLAREYGHVSSERLLSGPGLLAMARALAQ
RAGISLALGKPADVTRLAEQAACPVCREAIKVFSAVLGSVAADAVLNLVAIGGVYLIGNV
SKSLRAMMDFDALIEAFLEKGRFRALLDDVPIMQVMRSNTGLLGASAWRGR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
ttgttttatataagattttttaataatccgatgcttgttgtgctggcgtcaaagcagtcc
gatacaggacattcttctagcagggttgatcacatcatgaccgaatttccgcctcgtctg
attggcgatatcgggggcacgaatgtccgtttcgccctggcgatgggggaaggcgttatt
gtgcatgaacacaagctgcctgtcgcggaattcgacagtctggaactggcggccagaacc
tatttgcaggcacgtggttcgctcagccaggaggtggaggaagcggtgtttgccgttgcg
acaccggtgaagggcgatgaaatcgcttttaccaacaatccctggcgtttctcgattcgt
tcgactgaagcggcactggggctgaagaggctggaaatcatcaatgatttcgtagcccag
gcggcctccatccgggtaacgcctgatgaggaaatgacgatcatcaaatcaggtgaggtc
atggagcatcatcccgcagtagtgattgggccggggaccggtctcggtatggccttcatc
ctgcgtcgcaaggatggagaagagatcttggccagcgaaggcggccactgcacgttcagc
ccgcgtgatgaaacccagaccttcattcgcgatcaactggcgcgcgaatacggccatgtc
tcgtcggagcggctgctgtccggtccgggtttgctggctatggccagagcactggcgcag
cgtgcgggcatttctctggcgcttggaaaaccggccgatgtcacaaggctggccgagcag
gcggcctgtcctgtctgccgggaagcaatcaaggttttttctgccgtgctcggctcggtg
gcagcggatgcggtgctgaatttagtggctattggcggggtgtatctgattggaaatgtc
agcaaaagtctgcgcgccatgatggatttcgatgcgctgattgaggcgtttctggaaaaa
gggcggtttcgtgccctgctggatgatgtaccgatcatgcaggtaatgcgctccaacaca
ggtcttctgggggcgtcggcctggcgcgggcgctga

DBGET integrated database retrieval system