KEGG   Granulibacter bethesdensis: GbCGDNIH1_0987Help
Entry
GbCGDNIH1_0987    CDS       T00392                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
gbe  Granulibacter bethesdensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gbe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1124084..1124641
Genome map
AA seq 185 aa AA seqDB search
MRGIYNAQACSIRRFDEHIKMILIALGANLPNSDGMPAIETCRQAVARLGELPGLTLEAC
SRWYLTAPMPPSGQPDYVNGVARLSGEIDPERLLAWLQEIEARNGRVRTVPNAPRTLDLD
IIDMDGMVRSAPDPILPHPRATERAFVLTPLRDVCPDWIDPVSGKTVDDLLDALPPQGIR
PADSD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaggggcatttacaatgcacaagcctgcagcatacggcgatttgatgagcatataaaa
atgattttaatagcactcggggcaaatctgccgaattcagatggtatgccagccatcgaa
acctgccgccaggcggtggcacggctgggcgagttgcccggtctgactctggaagcctgc
tcccgttggtatctgacggcaccgatgccgccttccggtcagcctgattacgtaaatggt
gtagcccgcctgtccggtgaaatcgatcccgagcgccttttggcatggttgcaggagatc
gaggcgcgcaatggccgtgtccgtacggttcccaatgctcctcgcacacttgaccttgat
attatcgatatggatgggatggtcaggtccgcccctgatcctattctgccccacccaagg
gcgacagagcgtgcttttgtcctgacgccgctgcgggatgtgtgtccagactggattgat
cccgtcagtggtaaaacggttgatgatctgctggatgcgttgccgccacagggaataaga
ccggctgattctgactga

DBGET integrated database retrieval system