KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_1033Help
Entry
GbCGDNIH1_1033    CDS       T00392                                 

Definition
(RefSeq) glutathione peroxidase (EC:1.11.1.9)
  KO
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GbCGDNIH1_1033
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GbCGDNIH1_1033
Enzymes [BR:gbe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GbCGDNIH1_1033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1165603..1166082
Genome map
AA seq 159 aa AA seqDB search
MTSLYDFQATMLDGQVVPLSRWRGQVALVVNTASRCGFTPQYQGLEALYQRFAASGFVVL
GFPCNQFGAQEPGSSEEIRTFCDTRYSVSFPMFARVEVNGTNAHPLFDYLTRQRRGLLGT
RRIKWNFTKFLIGRDGVPVARYAPSCKPEKLEKAVYRLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtctttatgattttcaggcgaccatgctggatgggcaggtcgtaccgctgtcg
cgctggcgtgggcaggtggcgctggtcgtcaatacggccagccgttgtggctttaccccg
caatatcaggggctggaagcgctctaccagcgttttgccgcttccggcttcgtggtgctg
ggtttcccgtgcaatcagttcggcgcgcaggagccgggcagcagtgaggagatcaggact
ttttgtgatacgcgctacagcgtcagtttcccgatgtttgcgcgggtggaagtcaatggc
accaacgcccatccgctgttcgattatctgacccgtcagcgccgcggcctgctggggaca
cggcgcatcaagtggaatttcaccaaattcctgattggacgggacggcgtgccggtggcc
cgctatgccccgtcctgcaagccggaaaagctggaaaaagcggtctaccggctactctga

DBGET integrated database retrieval system