KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_1099Help
Entry
GbCGDNIH1_1099    CDS       T00392                                 

Definition
(GenBank) holliday junction DNA helicase ruvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GbCGDNIH1_1099
Enzymes [BR:gbe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     GbCGDNIH1_1099
DNA repair and recombination proteins [BR:gbe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     GbCGDNIH1_1099
    RecFOR pathway proteins
     GbCGDNIH1_1099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1227829..1228443
Genome map
AA seq 204 aa AA seqDB search
MIGRLTGLVDGLEEDRCLIDVNGVGYVVYASSRTLAALPRAPEVARVLIETQVREDAITL
FGFIDTAERDWFRLLTTVQGVGAKVGLNILSALSAGDLISALMAGDQRALTRASGVGPRL
AARIVSELKDKVGAMPSGPMTIGGVGVLSAPAGGVEQDTLSALLNLGYRRPEALAAIRRV
REALGEEAGLDAILRQCLRELAPG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcctcaccggactggtggatgggctggaggaggaccgctgcctgatcgac
gttaatggcgtgggatatgtggtctatgcatcctcccgcaccctggcggcgctgccccgt
gcgccggaggtggcgcgagtgctgatcgaaacgcaggtgcgggaagatgcgatcaccctg
ttcggctttatcgacacggcagagcgggactggttccgcctgctgaccaccgtgcagggg
gtcggggccaaagtggggttgaatatcctgtcagccttgtcggcgggtgatctgatttcg
gcgctgatggccggtgatcagcgtgccctgacccgcgccagcggtgtggggccaagactg
gcggcacggattgtctcggaattgaaagacaaggtgggtgccatgccctccggcccgatg
acgatcggcggcgtgggggtgctcagtgctcccgcaggcggtgtggagcaggatacatta
tcggcgctgctcaatctcggctaccgcaggccggaagcgctggcggcgatccgccgggtg
cgggaggcgttgggcgaagaggcagggcttgatgccatcctgcgccagtgcctgcgggag
cttgcacccggttga

DBGET integrated database retrieval system