KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_1111Help
Entry
GbCGDNIH1_1111    CDS       T00392                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GbCGDNIH1_1111
Enzymes [BR:gbe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     GbCGDNIH1_1111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1239631..1240677
Genome map
AA seq 348 aa AA seqDB search
MMRHQEAGAHKDILAPVEPLGLLNAEAARLAVSSGAAVPFLGGPLAFSLYRKGDSVFPAS
RLEEPERKRLTALRPRWAGFARPAIMGIINVTPDSFSDSGDRFDVGRAVADAEEMLAQGA
DILDIGGESTRPGSVPVPPEEEQRRILPVISALAARGAVISVDTRNASTMRKAFDAGGRI
FNDVSGLTHDSASLRLAAEAQCPVVLMHMRGTPATMMDGANTAYENVVEDVFYELQHLLN
EAEKAGIRRDNIALDPGIGFAKLNRHSVALLDRLPLLATLGCRLLIGVSRKGMIAALAGD
RTIPPKQRMPGSVAVALHALSRGADILRVHDVAETVQAVKIWMGLEAG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccatcaggaggcgggagcacataaggacattcttgctcccgtcgagccgctt
gggctgttgaatgcagaggcagcgcgtctggctgtatcgtcaggtgcggcggtgcctttt
ctcggcggtccgttggcattttctctatatagaaaaggtgattccgtttttcctgcgagc
cggctggaagaaccggaaaggaagagactgacagccctccgcccccgctgggccggtttt
gcgcgaccggccattatgggcatcatcaatgtcacgccagacagtttcagcgattccggt
gatcgcttcgatgttggtcgtgccgttgccgatgcagaagagatgctcgctcagggggcc
gatattctggatatcgggggggaaagcacccgtccgggcagtgttcccgtgccccctgaa
gaagaacagcggcgcattttgccggtcatcagcgctttggcagccagaggggcggtgatt
tctgtcgatacgcgcaatgcctccaccatgcggaaggcgtttgatgcgggggggcgtatt
ttcaatgatgtctccggcctgacgcatgattctgcttcacttcgtcttgcggcggaggct
cagtgtcccgtggtgctgatgcatatgcgcggtacaccggcgacgatgatggatggcgcc
aacaccgcctatgaaaacgtggtcgaggatgttttttacgagttgcagcatctgctgaac
gaagctgaaaaagcaggtatccgtcgagataatatcgcccttgatcccgggataggcttt
gccaagctgaaccgtcacagcgtggctttgctggatcggttgcctttgcttgctacactg
ggttgtcgcctgctgattggcgtatcgcgtaaaggtatgattgcggcactggccggggac
aggactattcctccgaaacagcgtatgcccggttcggtggcagttgctttgcacgcccta
tcgcgaggggccgatattttgcgggttcatgatgtggccgaaacggtgcaggccgtcaaa
atctggatgggattggaggctggttga

DBGET integrated database retrieval system