KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_1242Help
Entry
GbCGDNIH1_1242    CDS       T00392                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K13485  
2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase [EC:4.1.1.97]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GbCGDNIH1_1242
Enzymes [BR:gbe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.97  2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase
     GbCGDNIH1_1242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1380436..1380981)
Genome map
AA seq 181 aa AA seqDB search
MDGNRQPCWPFSRNMPREEFMALLEGIYENSPWVAEHAWRTEPFEDIQSLHAALKQAVNG
AEQPLQLSLIHAHPELAPDRAMQLTPASRSEQHAAGLDECDDARRHSLITLNRAYRERFG
YPFIIAVRGHGPDSIIAAMKARLSRTKREERQEALDQINRIAWFRLNDRFGHSASRDQPI
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggatggaaaccgtcagccctgctggccgttcagcaggaatatgccacgggaagaattt
atggcgctgctggaaggaatttacgaaaattcgccatgggttgccgaacatgcgtggcgg
acagagccttttgaagatatccagagcctgcatgcagcgttgaaacaggcagtgaacggc
gctgagcagccattacagctttccctgatccacgcccatccggaactggcgccggacagg
gcaatgcagttgactcctgcatcacgttccgagcagcacgcggccggacttgatgagtgc
gacgatgcgcgccggcatagtctgataacactcaaccgcgcctatcgtgagcgcttcggt
tatccctttatcattgcagtgagggggcatggtcctgacagcattatcgcagcgatgaaa
gcgcgcctgagcaggaccaagagggaggaaaggcaggaggctctggatcagattaatcgg
atcgcatggttcaggctgaatgacagattcggtcattctgcgagccgtgatcaaccgatt
gaatga

DBGET integrated database retrieval system