KEGG   Granulibacter bethesdensis: GbCGDNIH1_1242Help
Entry
GbCGDNIH1_1242    CDS       T00392                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K13485  
2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase [EC:4.1.1.-]
Organism
gbe  Granulibacter bethesdensis
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:gbe00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1380436..1380981)
Genome map
AA seq 181 aa AA seqDB search
MDGNRQPCWPFSRNMPREEFMALLEGIYENSPWVAEHAWRTEPFEDIQSLHAALKQAVNG
AEQPLQLSLIHAHPELAPDRAMQLTPASRSEQHAAGLDECDDARRHSLITLNRAYRERFG
YPFIIAVRGHGPDSIIAAMKARLSRTKREERQEALDQINRIAWFRLNDRFGHSASRDQPI
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggatggaaaccgtcagccctgctggccgttcagcaggaatatgccacgggaagaattt
atggcgctgctggaaggaatttacgaaaattcgccatgggttgccgaacatgcgtggcgg
acagagccttttgaagatatccagagcctgcatgcagcgttgaaacaggcagtgaacggc
gctgagcagccattacagctttccctgatccacgcccatccggaactggcgccggacagg
gcaatgcagttgactcctgcatcacgttccgagcagcacgcggccggacttgatgagtgc
gacgatgcgcgccggcatagtctgataacactcaaccgcgcctatcgtgagcgcttcggt
tatccctttatcattgcagtgagggggcatggtcctgacagcattatcgcagcgatgaaa
gcgcgcctgagcaggaccaagagggaggaaaggcaggaggctctggatcagattaatcgg
atcgcatggttcaggctgaatgacagattcggtcattctgcgagccgtgatcaaccgatt
gaatga

DBGET integrated database retrieval system