KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_1258Help
Entry
GbCGDNIH1_1258    CDS       T00392                                 

Definition
anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GbCGDNIH1_1258
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    GbCGDNIH1_1258
Enzymes [BR:gbe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     GbCGDNIH1_1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1394768..1395814)
Genome map
AA seq 348 aa AA seqDB search
MKAAIIGLSGPTLTSAEEAMLHTQRPAGVILFRRNISDPAQLKALTARLRSILPSEAALL
VDQEGGRVARLRPPHWRSHPPAAVIGRLYEADKKAGLRAAWLTGALIGLDCMGAGFDVVC
APVLDLLVPGAHDIVGDRAYGTDPGTVTLLGGAVMEGLLAAGVRPVMKHVPGHGRAHADS
HLELPVVPDELPAELEPFTRNAARFAGLPVWAMTAHILYEAWDRLRPATLSPVVIGQIIR
QRIGFNGLLVSDDIAMKALSGDPVSLTRQTLAAGCDVVLHCTGVQAETQAVLEGCPLLTD
QAHTLLAARPVASISIGDGESLAQERERLGLLEDGIRAKDPTEGHHPA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcgatcatcggcctgtccggcccgacccttacgtcggccgaggaggccatg
ctgcacacgcagcgtcccgcgggtgtcatcctgtttcgtcgcaatatcagcgatcctgcc
cagctgaaggccctgacggcaaggctgcgttccattctgccttcggaggcggccttgctg
gtggatcaggaaggtgggcgtgtggcgcggctgcggcctcctcactggcgatcccatccg
cctgctgctgtcattggccgtctgtatgaagcagataagaaggccgggctgcgggccgcc
tggttgaccggggcgctgatcgggctggactgcatgggggcagggtttgatgtggtttgt
gccccggtgctcgatctgctggtaccgggcgcccatgacattgtgggggatcgcgcatac
ggcaccgatcccggcacggtcacgctgttgggcggcgcggtgatggaagggctgctggcg
gctggcgtgcgccctgtgatgaagcacgtgccgggtcatggccgggcgcatgcggatagt
catctggaattgccggtcgtccctgatgaacttcctgccgagctggagcctttcacccgt
aatgccgcgcgttttgcgggccttcccgtctgggcgatgacagcgcatattctctacgaa
gcgtgggaccggctccgcccggccaccttatctcccgtggtgatcgggcagatcatccgg
caacgcatcggttttaatggtctgctggtttccgacgatatcgccatgaaggcactgagt
ggtgatcctgtttctctcacccgtcagacgctggcagccggatgcgacgtggtgctgcat
tgcaccggtgtgcaggcggagacacaggcggttctggaaggctgtccgttactgacggat
caggctcataccctgctggctgcccgtcctgttgcttccattagtatcggggatggggag
tctctggcgcaggaaagagagcgcctgggcttgctggaagatggtatccgcgccaaagac
ccgactgaaggccatcacccggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system