KEGG   Granulibacter bethesdensis: GbCGDNIH1_1258Help
Entry
GbCGDNIH1_1258    CDS       T00392                                 

Definition
anhydromuramoyl-peptide exo-beta-N-acetylglucosaminidase (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
gbe  Granulibacter bethesdensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gbe00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:gbe00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1394768..1395814)
Genome map
AA seq 348 aa AA seqDB search
MKAAIIGLSGPTLTSAEEAMLHTQRPAGVILFRRNISDPAQLKALTARLRSILPSEAALL
VDQEGGRVARLRPPHWRSHPPAAVIGRLYEADKKAGLRAAWLTGALIGLDCMGAGFDVVC
APVLDLLVPGAHDIVGDRAYGTDPGTVTLLGGAVMEGLLAAGVRPVMKHVPGHGRAHADS
HLELPVVPDELPAELEPFTRNAARFAGLPVWAMTAHILYEAWDRLRPATLSPVVIGQIIR
QRIGFNGLLVSDDIAMKALSGDPVSLTRQTLAAGCDVVLHCTGVQAETQAVLEGCPLLTD
QAHTLLAARPVASISIGDGESLAQERERLGLLEDGIRAKDPTEGHHPA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcgatcatcggcctgtccggcccgacccttacgtcggccgaggaggccatg
ctgcacacgcagcgtcccgcgggtgtcatcctgtttcgtcgcaatatcagcgatcctgcc
cagctgaaggccctgacggcaaggctgcgttccattctgccttcggaggcggccttgctg
gtggatcaggaaggtgggcgtgtggcgcggctgcggcctcctcactggcgatcccatccg
cctgctgctgtcattggccgtctgtatgaagcagataagaaggccgggctgcgggccgcc
tggttgaccggggcgctgatcgggctggactgcatgggggcagggtttgatgtggtttgt
gccccggtgctcgatctgctggtaccgggcgcccatgacattgtgggggatcgcgcatac
ggcaccgatcccggcacggtcacgctgttgggcggcgcggtgatggaagggctgctggcg
gctggcgtgcgccctgtgatgaagcacgtgccgggtcatggccgggcgcatgcggatagt
catctggaattgccggtcgtccctgatgaacttcctgccgagctggagcctttcacccgt
aatgccgcgcgttttgcgggccttcccgtctgggcgatgacagcgcatattctctacgaa
gcgtgggaccggctccgcccggccaccttatctcccgtggtgatcgggcagatcatccgg
caacgcatcggttttaatggtctgctggtttccgacgatatcgccatgaaggcactgagt
ggtgatcctgtttctctcacccgtcagacgctggcagccggatgcgacgtggtgctgcat
tgcaccggtgtgcaggcggagacacaggcggttctggaaggctgtccgttactgacggat
caggctcataccctgctggctgcccgtcctgttgcttccattagtatcggggatggggag
tctctggcgcaggaaagagagcgcctgggcttgctggaagatggtatccgcgccaaagac
ccgactgaaggccatcacccggcctga

DBGET integrated database retrieval system