KEGG   Granulibacter bethesdensis: GbCGDNIH1_1316Help
Entry
GbCGDNIH1_1316    CDS       T00392                                 

Definition
glucoamylase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
gbe  Granulibacter bethesdensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gbe00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1465872..1467863)
Genome map
AA seq 663 aa AA seqDB search
MPSEEISRQARCFLSQTGCYSSVGQGCMKEEGDRDASDKYPLHAVFSRWCAVTLDDLPMA
IEDYGLIGDCRTAALVSRHGSIDWLCWPRFDGAACFAALLGQARHGRWAIAPEALGKTPE
KVSITRRYRGDTLVLETVFTTDTGEVALIDFMPVHPDPDDDGSSLIRIVEGRKGSVEMQM
HLVLRFDYGISVPWVMHLDDEEGITAIAGPAMTVLRTPVEIEGENLSSIARFTVTEGRKI
PFVLSYGPSHLPPPVRLDAEEELRHTEAWWHEWSSQCTYEGPWRDVMQRSLITLKALTYA
PTGGIVAAATTSLPEEIGGSRNWDYRYCWLRDSTLTLFALMHGGHRQEAQEWRDWLHRSI
AGKAEQIQIMYGLAGERRLDEWSVPWLPGYENSSPVRIGNGAAGQLQLDVYGEVIDTLYQ
ARERGLQVPASSWSLEKALVKYLETIWQEPDEGLWEVRGGRQHFTFSKAMVWLAFDRMVL
NAEHFGLEGPVDHWRALRDEVHERVCREGFNKEMNSFVQYFGGDTLDASLLVLPLIGFLP
ATDPRMVGTVAAIERTLLKDGFVYRYRTEEGTDGLPGDEGAFLVCTFWLADNYVLQGRQD
EAVRMLERLLAIQSDLGLFAEEYDPHRKRQVGNFPQAFSHVGLIATILNIADGGPAYQRK
ERS
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
ttgccgtcagaggaaatatcaaggcaggctaggtgcttcctgtcgcaaaccgggtgttat
agctccgttggtcagggctgcatgaaagaagaaggagacagagatgcgtctgataaatac
ccccttcatgccgttttcagcaggtggtgcgctgtgacgctcgatgatcttcccatggct
atcgaggattatggtctgatcggtgattgccggacggcggcactggtcagccgtcacggt
tccattgactggctctgctggcccagattcgatggagcagcctgctttgccgcacttctg
gggcaggcacgtcacggtcgttgggccattgcgccggaagcattgggcaagaccccggaa
aaggtgagcatcacaaggcggtatcggggtgatacgctggtactggagacggttttcacg
accgataccggtgaagtcgcgttgatcgacttcatgccggtgcatccggacccggacgac
gatggttcttccctgatccgtatcgtggagggcagaaaaggctcggtagagatgcagatg
catcttgtgctgcggttcgattacgggatttccgttccatgggtcatgcatcttgatgac
gaggaagggattactgccattgccggccctgccatgacggtgctgcgaacgccggtggag
attgagggagagaatctgtccagcattgcccggtttacggtgacagagggccggaaaatt
ccgttcgttctgtcctacggcccgtctcatctgcctcctccggttcggctggatgccgag
gaggagcttcggcataccgaggcatggtggcatgaatggagcagccagtgcacctatgag
gggccatggcgggatgtcatgcaacgctcgctgatcacgttgaaggcgctgacttatgcc
ccaaccggtggcattgttgctgctgcaactacgtccttgccggaggaaatcggtggcagc
cgtaactgggattaccgttattgctggttgcgggattccacgctgaccctgttcgccctg
atgcatggcggccacaggcaggaagcgcaggaatggcgtgactggttgcatcggagcatt
gccgggaaggccgaacagatccagatcatgtacgggctggccggtgaacgccgtctggat
gaatggtcagtgccatggctgcccgggtatgaaaattcctccccggttcgcatcggcaat
ggggctgccgggcagttgcagcttgatgtctatggagaagtcatcgacacgctgtaccag
gcacgggagagagggctgcaagtgccggcttcctcctggagtctggaaaaagcgctggtc
aaatatctcgaaaccatatggcaggagccggatgaagggctgtgggaggtccggggcgga
cgtcagcatttcaccttctccaaggcgatggtctggctggctttcgatcggatggttctg
aatgccgagcatttcgggctggaggggccagtcgatcactggcgtgccctgcgtgatgaa
gtgcatgagcgggtctgccgcgagggcttcaacaaggagatgaacagcttcgtgcagtat
ttcggcggcgatacgctggatgcgagcctgctggtgctgcctctgatcggatttctgccg
gcaactgatccccgtatggtggggaccgtggcggcgatagagcggactctgctcaaggat
ggtttcgtgtaccgctatcgcacggaggagggcacggatggcctgccgggcgatgaaggt
gcttttctggtctgcactttctggttggcggataattacgttttgcaggggcggcaagat
gaagccgtcagaatgctggaacgcctgctggccatccagagtgatctcggattgtttgcc
gaggaatacgacccccatcgcaaacggcaggttggtaatttcccgcaggctttctcgcat
gttggtctgatcgcgacgatcctgaacattgctgatggcggccctgcctatcaacgtaag
gagcgttcataa

DBGET integrated database retrieval system