KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_1342Help
Entry
GbCGDNIH1_1342    CDS       T00392                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K17364  
dihydromethanopterin reductase [EC:1.5.1.47]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GbCGDNIH1_1342
Enzymes [BR:gbe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.47  dihydromethanopterin reductase
     GbCGDNIH1_1342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1497395..1497856
Genome map
AA seq 153 aa AA seqDB search
MPNHNKSLCLSSWPAEIRSMCAIGSGGQLGLNGKLPWQGDQRPAFREDVRRFWERTLGHV
LLCGPATYRSIPATAFTARDILELRSSMQPEDVLSRYPGRIVYIGGGLAVWNTYARFIQH
WDITRLPYDGPADRYFDPAWLATGAGARETSRP
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtgccaaaccataacaaatccttatgcctttcttcatggcccgccgagatccgttccatg
tgcgcgatcggttcaggcggacagctcggcctgaacgggaaactgccatggcagggtgac
cagcgtccggccttccgcgaggatgtccgccgtttctgggaacgtacgctcggacatgtc
ctgctatgcggaccagcaacctatcgtagcattccagcgacggcctttaccgcaagggac
atcctcgaactccgctcctccatgcagccagaggacgtgttgagtcgctatcccggccgg
atcgtatatatcggtggcggtttagccgtctggaatacttatgcccgcttcatccagcac
tgggacatcacccgactgccttatgacggacccgctgatcgctatttcgatccggcgtgg
cttgcaaccggcgccggggcaagagaaacttcacgtccttaa

DBGET integrated database retrieval system