KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_1706Help
Entry
GbCGDNIH1_1706    CDS       T00392                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GbCGDNIH1_1706
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GbCGDNIH1_1706
Enzymes [BR:gbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     GbCGDNIH1_1706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1921451..1922596
Genome map
AA seq 381 aa AA seqDB search
MSGSGHEQDEALPRLTTARRLVIKLGSALVVDSKAATPRIEWLRGVAADIAMLRRQGVQV
IVVSSGAIALARQALKLTQPRLRLEEKQAAASVGQIRLAQAWSEALSAEGMTAAQLLLTL
GDTEDRRRYLNARATLSALLGMGCVPVINENDSVATAEIRFGDNDRLAARVAEMVQADQL
VLLSDIDGLYTADPRRDPEASHLPVVRAITPEIEAMGGEPPPGYSSGGMRTKLTAARIAT
GAGCAMAIALGHTDHPLRALAEGARCTWFLPLPEGRTARKRWIAGSLQPMGTLTVDDGAR
RALLRGGSLLPAGVVSVDGRFERGDPVLVQGLDGTVLARGLSAYASRDASRIVGRRSEDI
ESILGWRGRDELVHRDDLVLI
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtagcggtcatgagcaggatgaagccctgccccggctgaccactgcgcgccgt
ctagtcatcaagctgggcagtgctctggtggtggatagcaaggccgccactccccgcatc
gagtggctgcggggggtcgctgcggatattgccatgctgcgccgtcagggtgtgcaggtg
atcgtggtctcatccggggccatagcgctggcacgacaggcactgaaactcactcagccc
cggctgcgtctggaggaaaaacaggcggctgcttcggtcggccagatccgtctggcacag
gcatggagcgaggcgctctccgcggagggcatgaccgccgcccagcttctgctgacgctc
ggcgataccgaggatcgccgccgttacctcaatgcccgcgccacgctatcggccctgctg
ggcatggggtgtgtgccggtcatcaacgagaatgacagcgtggccacagcggaaatccgc
tttggcgacaatgaccgtctggccgcccgcgtggccgaaatggtgcaggccgatcaattg
gtcctgctgtcggacatagacgggctttatacggctgatccacggcgtgatccagaagcc
agccatctgccggtggtccgggccatcacgccggagatcgaggccatgggcggagagcct
ccccccggttattccagcggcggcatgcggaccaagctgaccgcggcccgcattgcaacc
ggggccggatgcgccatggcgattgcgctggggcataccgatcatccgctccgtgcactg
gcggagggggcgcgctgcacatggttcctgccgctgccagaggggcgcacggcccgcaaa
cgctggattgccggcagcctgcaaccgatgggcacactgacagttgatgacggtgcccgc
cgcgcactcctgcggggtggctccctgctgccagccggagtcgtctctgtcgatggccga
tttgagcgcggtgaccccgtgctggtacaaggacttgatggcactgtgctggcaaggggc
ctgtccgcctatgccagcagggacgcctcccgaattgtcggacgacgctcggaggatatc
gaatccatcctcggctggcgtggccgggacgaactggtccatcgggatgatcttgttctg
atatga

DBGET integrated database retrieval system