KEGG   Granulibacter bethesdensis: GbCGDNIH1_1706Help
Entry
GbCGDNIH1_1706    CDS       T00392                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
gbe  Granulibacter bethesdensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gbe01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gbe00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1921451..1922596
Genome map
AA seq 381 aa AA seqDB search
MSGSGHEQDEALPRLTTARRLVIKLGSALVVDSKAATPRIEWLRGVAADIAMLRRQGVQV
IVVSSGAIALARQALKLTQPRLRLEEKQAAASVGQIRLAQAWSEALSAEGMTAAQLLLTL
GDTEDRRRYLNARATLSALLGMGCVPVINENDSVATAEIRFGDNDRLAARVAEMVQADQL
VLLSDIDGLYTADPRRDPEASHLPVVRAITPEIEAMGGEPPPGYSSGGMRTKLTAARIAT
GAGCAMAIALGHTDHPLRALAEGARCTWFLPLPEGRTARKRWIAGSLQPMGTLTVDDGAR
RALLRGGSLLPAGVVSVDGRFERGDPVLVQGLDGTVLARGLSAYASRDASRIVGRRSEDI
ESILGWRGRDELVHRDDLVLI
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtagcggtcatgagcaggatgaagccctgccccggctgaccactgcgcgccgt
ctagtcatcaagctgggcagtgctctggtggtggatagcaaggccgccactccccgcatc
gagtggctgcggggggtcgctgcggatattgccatgctgcgccgtcagggtgtgcaggtg
atcgtggtctcatccggggccatagcgctggcacgacaggcactgaaactcactcagccc
cggctgcgtctggaggaaaaacaggcggctgcttcggtcggccagatccgtctggcacag
gcatggagcgaggcgctctccgcggagggcatgaccgccgcccagcttctgctgacgctc
ggcgataccgaggatcgccgccgttacctcaatgcccgcgccacgctatcggccctgctg
ggcatggggtgtgtgccggtcatcaacgagaatgacagcgtggccacagcggaaatccgc
tttggcgacaatgaccgtctggccgcccgcgtggccgaaatggtgcaggccgatcaattg
gtcctgctgtcggacatagacgggctttatacggctgatccacggcgtgatccagaagcc
agccatctgccggtggtccgggccatcacgccggagatcgaggccatgggcggagagcct
ccccccggttattccagcggcggcatgcggaccaagctgaccgcggcccgcattgcaacc
ggggccggatgcgccatggcgattgcgctggggcataccgatcatccgctccgtgcactg
gcggagggggcgcgctgcacatggttcctgccgctgccagaggggcgcacggcccgcaaa
cgctggattgccggcagcctgcaaccgatgggcacactgacagttgatgacggtgcccgc
cgcgcactcctgcggggtggctccctgctgccagccggagtcgtctctgtcgatggccga
tttgagcgcggtgaccccgtgctggtacaaggacttgatggcactgtgctggcaaggggc
ctgtccgcctatgccagcagggacgcctcccgaattgtcggacgacgctcggaggatatc
gaatccatcctcggctggcgtggccgggacgaactggtccatcgggatgatcttgttctg
atatga

DBGET integrated database retrieval system