KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_1815Help
Entry
GbCGDNIH1_1815    CDS       T00392                                 

Definition
(GenBank) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
gbe00071  Fatty acid degradation
gbe00280  Valine, leucine and isoleucine degradation
gbe00310  Lysine degradation
gbe00360  Phenylalanine metabolism
gbe00362  Benzoate degradation
gbe00380  Tryptophan metabolism
gbe00410  beta-Alanine metabolism
gbe00627  Aminobenzoate degradation
gbe00640  Propanoate metabolism
gbe00650  Butanoate metabolism
gbe00903  Limonene and pinene degradation
gbe00930  Caprolactam degradation
gbe01100  Metabolic pathways
gbe01110  Biosynthesis of secondary metabolites
gbe01120  Microbial metabolism in diverse environments
gbe01130  Biosynthesis of antibiotics
gbe01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GbCGDNIH1_1815
   00650 Butanoate metabolism
    GbCGDNIH1_1815
  Lipid metabolism
   00071 Fatty acid degradation
    GbCGDNIH1_1815
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GbCGDNIH1_1815
   00310 Lysine degradation
    GbCGDNIH1_1815
   00360 Phenylalanine metabolism
    GbCGDNIH1_1815
   00380 Tryptophan metabolism
    GbCGDNIH1_1815
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GbCGDNIH1_1815
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GbCGDNIH1_1815
   00281 Geraniol degradation
    GbCGDNIH1_1815
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GbCGDNIH1_1815
   00627 Aminobenzoate degradation
    GbCGDNIH1_1815
   00930 Caprolactam degradation
    GbCGDNIH1_1815
Enzymes [BR:gbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GbCGDNIH1_1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ABI62713
UniProt: Q0BR39
Position
2043919..2044998
Genome map
AA seq 359 aa AA seqDB search
MEQENLISPAPTVAIQAGTVQTVAIRQSGPTGWITLNRPSALNALNGEMVRAIQQTLNLW
RDDPAVTAIILQGTGRAFCAGADVRRLREAVLADDMDVVETFFREEYTLDHTIATYPKPV
LALVDGLCVGGGMGLAMHAHSLVATRAASFGMPETAIGLFPDVGASQVLPQLRGRTGLYM
ALTGRPIPAEMAHAAGLLTHLWPGEMSELVAGLEKHGLAALVETDLPVPSSAFDHVFSRI
DTCFSGTSLIDILDALAGETSQWGEETLAAIREKSPAALCWTFEMMRTGQKLTLQQALNR
DLAMAMTVTRLPDFAEGIRALLVDKDRTPHWQDARVEDVDAAMIASVLQSAASYPGTVC
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtggaacaagaaaacctgatttcccccgcccctactgtcgcaatccaggctggcacagtc
cagactgtcgcaatccggcagagcggcccgaccggctggatcacgctcaaccgcccctcg
gcccttaacgcgctgaatggggaaatggtacgagccattcagcagactctgaacctctgg
cgtgatgatccagccgtcaccgccatcatattgcagggtaccgggcgcgctttctgtgcc
ggagccgatgtgaggcgtttacgggaagccgtactggccgacgatatggacgtcgtggaa
acatttttccgcgaggagtatacgctcgatcataccattgcgacctatccaaagcctgtt
cttgctctggtcgacggattatgtgtcggtggcggcatggggttggcaatgcatgcccat
agtctggttgcgacccgcgctgcctccttcggtatgcctgaaacagccatcggcctgttt
ccggatgtcggcgccagccaggtactaccgcagttgcgaggccggaccggactttacatg
gcactgaccggacgccccatccccgccgagatggcccatgctgccggacttctcacgcat
ctctggcccggagaaatgtccgagcttgtcgccggtctggaaaaacacggtctggctgca
ctggtggaaaccgatcttcccgttccttcctccgcctttgaccatgttttctcacggatc
gacacctgcttctccggcacttcgctcattgacattctcgacgcccttgcgggcgagaca
agccaatggggggaggaaacacttgccgccatacgcgaaaaatcacctgccgcgctgtgc
tggaccttcgagatgatgcgaaccggtcagaagctgacgcttcaacaggcccttaaccgg
gatctggccatggccatgaccgtcaccagattgcccgattttgcggagggtattcgtgcc
ctgctggtagacaaggatcgcacaccacattggcaggatgcgcgggtcgaggatgtcgat
gccgccatgatcgccagcgtgttgcaatccgctgcatcctatccgggcacagtctgctga

DBGET integrated database retrieval system