KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_1910Help
Entry
GbCGDNIH1_1910    CDS       T00392                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    GbCGDNIH1_1910
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GbCGDNIH1_1910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2145970..2146485
Genome map
AA seq 171 aa AA seqDB search
MPCRCRKIASRMPRRTAIGKGVNKIMSRRGSLGAVPFRTTLQRDETMQSKLVPALAFSAF
ALLASGQAHADGDAEAGKTLFKKCGFCHSTEAGKNKVGPSLAAIVGRKAGVEPGFNYSDA
LKSSGLTWDEATLNKWVENPKGLVSGTKMIFPGIKDEKDRQNLIAYLKTLK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgccatgccggtgccgcaaaattgcctcaagaatgcctcgacgaacggctatcggaaag
ggcgtcaacaagataatgtcccggcgcggctcattgggggccgtgcctttccgaaccacc
ttgcaacgggacgaaacgatgcaaagcaaactggttcctgctctcgctttttccgctttt
gcgctgctggcctccggccaggcgcacgcggatggcgatgccgaagcaggtaagaccctc
ttcaagaagtgcggcttctgccactccaccgaagccggcaagaacaaggtcggcccctcc
ctggccgccatcgtcggtcgcaaggcaggtgtcgagcctggcttcaactactccgatgcc
ctgaaaagctccggcctgacctgggacgaagccactctgaacaaatgggttgagaatccg
aaaggcctggtatccggcacgaagatgatcttccccggcatcaaggacgagaaggatcgc
cagaacctgatcgcctatctgaagactctcaagtaa

DBGET integrated database retrieval system