KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_1978Help
Entry
GbCGDNIH1_1978    CDS       T00392                                 

Definition
nucleoside-diphosphate-sugar epimerases
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Brite
Enzymes [BR:gbe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     GbCGDNIH1_1978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2221691..2222725
Genome map
AA seq 344 aa AA seqDB search
MTSPGRAFITGATGFVGSAVARALLQRGWQVRLLTRRSSDTRNLAGLTADIVEGDLLQPE
SITPHLHGCQALFHVAADYRIWVPEPEAMMRANVDGTVALLRAAQAAGIERIVYCSSVAA
LGLIGDGTPSTEDTPNSEAKTVGIYKKSKYRAEQAVLRLVAEEGVRAVIVNPSTPIGPRD
VKPTPTGRMIRDAALGKMPAYLDTGLNVVHVDDVAEGHLLAMEHGVPGERYILGGTDMHL
ADILAMVARETGRKPPRIRLNETLLWPLAMASETLARLTGIEPLVTRDHLRMARKKMFFS
SAKARTAFGWSPRPAEEAIRDAVSWFRQNDPAFIRQRPVKGTAA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtccgggacgggccttcattaccggagcaaccggctttgtcggttcggccgtc
gcgcgtgctttgctgcaacgaggctggcaggtcaggctgctgacccggcgcagctccgac
acgcggaaccttgccggtctcaccgcggacattgtggagggtgatctgctgcagcccgaa
agcatcacaccccatctgcacggctgtcaggccctgtttcatgtcgctgccgattaccgc
atctgggtgccggaaccggaggccatgatgcgtgccaatgtcgatggtaccgtggctctg
ctgcgcgcggctcaggcagccggaattgagcgaatcgtctattgcagttccgtcgcggcg
ctgggcctgattggtgacggcaccccctccaccgaggatacgccgaacagcgaggccaag
actgtcggcatctataagaaatcaaaatatcgggccgaacaggctgttctgcggctggtg
gcggaggaaggggtgagggcagtgatcgtcaatccctccacaccgatcgggccgcgtgac
gtaaagccgacaccgaccgggcgcatgatccgggatgcagctttgggtaaaatgcctgcc
tatctcgataccggtctgaacgtcgtgcatgtggatgacgtcgcggaaggacatcttctt
gccatggagcatggcgtgccgggcgaacgctatattctgggcggcaccgacatgcatctg
gcggatattctggccatggtggcgcgggagacaggacgcaaaccaccacgcatccggctg
aatgaaaccttgctgtggccgctggcgatggccagcgagacactggcacgtctcaccgga
atcgaaccgctggtcacgcgggatcatctgcgcatggcccgcaagaagatgtttttttcc
tccgccaaggcccgcaccgcgttcggctggtcgccccgcccggcagaggaggcgattcgt
gatgccgtttcgtggttccgtcagaacgatcccgctttcatcagacagcggcccgtcaaa
ggaaccgccgcatga

DBGET integrated database retrieval system