KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_1983Help
Entry
GbCGDNIH1_1983    CDS       T00392                                 

Definition
asparagine synthetase family protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GbCGDNIH1_1983
Enzymes [BR:gbe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     GbCGDNIH1_1983
Peptidases [BR:gbe01002]
 Cysteine Peptidases
  Family C44
   GbCGDNIH1_1983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2225849..2227606)
Genome map
AA seq 585 aa AA seqDB search
MCGIAGVIMASGQASPDPSLLGDLATALHHRGPDGSGHTQIGRVAMVHTRLAIVDPEGGD
QPIFAGSSALVANGEIYNDLALREAMPDVSFSTGSDCEPPLHLWLREGPDYAVRLRGMYA
IAIHERAARTVTLSRDPFGIKPLYVARLAGGVAFASQPSALLDAGLVKRDVADAQRNELL
QLQFTTGADTIFPGIQRVLPGETLICRDGQILDRRRISALPEGPAEEIGEDEALARLDAA
LEESVALHQRADVPYGMFLSGGIDSATVLSLMARLNDSPVLAFTAGFDVPGAADEREHAA
ALAAAAGARHRTVTVTQSMVWQHLPEIVACMDDPAADYAIIPTWFLARRAREDVKVVLSG
EGGDELFGGYGRYRSAMRPWWRGGRVMRSKGHFDGLDVLHAIPPGWRDGIAAAESHVSPL
RSRLAAAQETDMTDWLPHDLLLKLDRCLMAHGVEGRTPLLDPGVAAAAFRLPDRLKVQDG
KGKYILRRWLERHSPQARPFAAKQGFTVPVAAWIAARGQELGPLVARQRCIQAIARPDRV
VSLFRHAHGRREGFAAWILLFYALWHRAHIEAKSMEGDVFSVLAD
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattgcgggcgttatcatggcttccgggcaggcgtcgcctgatccttccctg
ttgggcgatctggccaccgccttgcaccatcgtgggccggatggcagcggccatacccag
atcggccgggtggcgatggtgcatacccgtctggccattgtcgatccggaagggggcgat
cagccgattttcgccggctcctcggccctggtggccaatggcgagatttataacgatctt
gcgctgcgtgaagcgatgccggacgtgtcgttctcgaccggcagcgattgcgagccgccc
ttgcatctctggttgcgggaggggcctgattacgctgtcagactgcgcggcatgtatgcc
atcgcgatccatgagcgggccgcacgtacagtcactttgagccgcgatccgttcgggatc
aagccgctttacgtggcccggctggcagggggggtggcctttgcctcccaaccctcggcc
ctgctcgacgccggtctggtcaaacgcgatgtggccgatgcccagcgtaacgagctgctt
cagcttcagttcaccaccggagcagatacgatttttccgggtattcagcgcgtgttgccg
ggcgagacgctgatctgccgcgacgggcagattctggatcgccgccgcatcagcgccctg
cccgaaggccccgccgaggagatcggggaggatgaggcattggcgcgtctggatgccgcc
ctggaagaaagcgtggcactgcatcagcgtgcggatgtgccttatggcatgtttctgtca
ggaggcatcgacagcgccacggtgctgagcctgatggcacggctgaatgacagcccggtc
ttggctttcacggccggatttgacgtgcccggcgcggctgatgagcgtgagcatgctgct
gcattggcggcggcggcaggcgcacggcaccgtaccgtgacggtaacgcaatcaatggtc
tggcagcatctgccggagatcgtggcctgcatggacgatcccgcggcggattatgcgatc
atccccacctggtttctggcgcgccgggcaagagaggacgtgaaggttgtcctctccggt
gagggaggagacgagttgttcggcggctatggacggtatcgcagcgcgatgcgcccatgg
tggcgtggcgggcgggtcatgcgatcgaaagggcatttcgatggtctggatgtactgcat
gccattccacccggctggcgggacggaattgcggctgctgaaagtcatgtttctccgttg
cgctcacgccttgcagcggcacaggaaaccgacatgacagactggctgccgcatgatctg
ctgctgaagctggatcgctgtctgatggctcatggggtggagggacgcactccgctgctc
gatcccggcgttgccgccgctgctttccgtctgccggaccggttgaaggttcaggatggc
aaaggcaaatacattctccgtcgctggctggagcggcacagccctcaggcaagacctttt
gcagccaagcagggctttaccgtgccggttgccgcctggatcgctgcgcgggggcaggag
ctcgggccgctggtggcacggcagagatgtattcaggccatcgcccgccctgatcgcgtg
gtcagtctgttccgccatgcacatgggcgcagggagggatttgccgcctggatcctgctg
ttctacgcgctgtggcaccgtgcgcatattgaagcgaaatcgatggaaggagatgtcttt
tcggttctggccgactga

DBGET integrated database retrieval system