KEGG   Granulibacter bethesdensis: GbCGDNIH1_1983Help
Entry
GbCGDNIH1_1983    CDS       T00392                                 

Definition
asparagine synthetase family protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gbe  Granulibacter bethesdensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gbe00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2225849..2227606)
Genome map
AA seq 585 aa AA seqDB search
MCGIAGVIMASGQASPDPSLLGDLATALHHRGPDGSGHTQIGRVAMVHTRLAIVDPEGGD
QPIFAGSSALVANGEIYNDLALREAMPDVSFSTGSDCEPPLHLWLREGPDYAVRLRGMYA
IAIHERAARTVTLSRDPFGIKPLYVARLAGGVAFASQPSALLDAGLVKRDVADAQRNELL
QLQFTTGADTIFPGIQRVLPGETLICRDGQILDRRRISALPEGPAEEIGEDEALARLDAA
LEESVALHQRADVPYGMFLSGGIDSATVLSLMARLNDSPVLAFTAGFDVPGAADEREHAA
ALAAAAGARHRTVTVTQSMVWQHLPEIVACMDDPAADYAIIPTWFLARRAREDVKVVLSG
EGGDELFGGYGRYRSAMRPWWRGGRVMRSKGHFDGLDVLHAIPPGWRDGIAAAESHVSPL
RSRLAAAQETDMTDWLPHDLLLKLDRCLMAHGVEGRTPLLDPGVAAAAFRLPDRLKVQDG
KGKYILRRWLERHSPQARPFAAKQGFTVPVAAWIAARGQELGPLVARQRCIQAIARPDRV
VSLFRHAHGRREGFAAWILLFYALWHRAHIEAKSMEGDVFSVLAD
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattgcgggcgttatcatggcttccgggcaggcgtcgcctgatccttccctg
ttgggcgatctggccaccgccttgcaccatcgtgggccggatggcagcggccatacccag
atcggccgggtggcgatggtgcatacccgtctggccattgtcgatccggaagggggcgat
cagccgattttcgccggctcctcggccctggtggccaatggcgagatttataacgatctt
gcgctgcgtgaagcgatgccggacgtgtcgttctcgaccggcagcgattgcgagccgccc
ttgcatctctggttgcgggaggggcctgattacgctgtcagactgcgcggcatgtatgcc
atcgcgatccatgagcgggccgcacgtacagtcactttgagccgcgatccgttcgggatc
aagccgctttacgtggcccggctggcagggggggtggcctttgcctcccaaccctcggcc
ctgctcgacgccggtctggtcaaacgcgatgtggccgatgcccagcgtaacgagctgctt
cagcttcagttcaccaccggagcagatacgatttttccgggtattcagcgcgtgttgccg
ggcgagacgctgatctgccgcgacgggcagattctggatcgccgccgcatcagcgccctg
cccgaaggccccgccgaggagatcggggaggatgaggcattggcgcgtctggatgccgcc
ctggaagaaagcgtggcactgcatcagcgtgcggatgtgccttatggcatgtttctgtca
ggaggcatcgacagcgccacggtgctgagcctgatggcacggctgaatgacagcccggtc
ttggctttcacggccggatttgacgtgcccggcgcggctgatgagcgtgagcatgctgct
gcattggcggcggcggcaggcgcacggcaccgtaccgtgacggtaacgcaatcaatggtc
tggcagcatctgccggagatcgtggcctgcatggacgatcccgcggcggattatgcgatc
atccccacctggtttctggcgcgccgggcaagagaggacgtgaaggttgtcctctccggt
gagggaggagacgagttgttcggcggctatggacggtatcgcagcgcgatgcgcccatgg
tggcgtggcgggcgggtcatgcgatcgaaagggcatttcgatggtctggatgtactgcat
gccattccacccggctggcgggacggaattgcggctgctgaaagtcatgtttctccgttg
cgctcacgccttgcagcggcacaggaaaccgacatgacagactggctgccgcatgatctg
ctgctgaagctggatcgctgtctgatggctcatggggtggagggacgcactccgctgctc
gatcccggcgttgccgccgctgctttccgtctgccggaccggttgaaggttcaggatggc
aaaggcaaatacattctccgtcgctggctggagcggcacagccctcaggcaagacctttt
gcagccaagcagggctttaccgtgccggttgccgcctggatcgctgcgcgggggcaggag
ctcgggccgctggtggcacggcagagatgtattcaggccatcgcccgccctgatcgcgtg
gtcagtctgttccgccatgcacatgggcgcagggagggatttgccgcctggatcctgctg
ttctacgcgctgtggcaccgtgcgcatattgaagcgaaatcgatggaaggagatgtcttt
tcggttctggccgactga

DBGET integrated database retrieval system