KEGG   Granulibacter bethesdensis: GbCGDNIH1_1992Help
Entry
GbCGDNIH1_1992    CDS       T00392                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
gbe  Granulibacter bethesdensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:gbe00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:gbe02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2237040..2237525)
Genome map
AA seq 161 aa AA seqDB search
MKSVMIWAVAFGAAALTLAGWCLLPAMWGDETPVPVPSIALLMASADPAKGEVAAERHCH
RCHALTGSPDARTVAPPLRGVIGRERASVPGFHYSHALKEMHGQWDTDSLNAWLFRPSAF
APGTRMSFAGVKDDRERADIIAYLRVISGLPPASIRQSGQP
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcggtcatgatctgggcagtggcgttcggcgcggcagcgcttacgctcgccgga
tggtgcctgttgccggccatgtggggggatgaaaccccggttccggtgccctcgatcgcc
ttgctgatggccagcgctgatccggcgaagggcgaggtggccgccgaacggcattgtcac
cgttgtcacgctttgacaggatcgcccgatgcccgcaccgtggcgccgcccttgcgcggc
gtgatagggcgggaacgtgcgtcggttcccggttttcactattcccatgccttgaaagag
atgcacggacaatgggatacggactccctcaatgcctggcttttccggccgtccgctttt
gctcccggtacccgtatgtcgtttgccggggtgaaggatgatcgggaaagagctgacatc
atagcctatctgcgcgtcatttccggtctgccgccggcttccatacggcagtccgggcaa
ccgtga

DBGET integrated database retrieval system