KEGG   Granulibacter bethesdensis CGDNIH1: GbCGDNIH1_2002Help
Entry
GbCGDNIH1_2002    CDS       T00392                                 

Definition
exodeoxyribonuclease III (EC:3.1.11.2)
Orthology
K01142  
exodeoxyribonuclease III [EC:3.1.11.2]
Organism
gbe  Granulibacter bethesdensis CGDNIH1
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:gbe00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    GbCGDNIH1_2002
Enzymes [BR:gbe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     GbCGDNIH1_2002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2244304..2245131)
Genome map
AA seq 275 aa AA seqDB search
MALMRVRVATWNINSLRLRLPLLEKVLAELDPDVLCLQETKVPDPLFPADLFPGRAAEHH
GYAHVAYRGMKGYNGVAILSRIPFTVDEAAPDWCAKGDCRHMAVSLAVPSGPVALHNFYV
PAGGDEPDPAINPKFAHKLAFVEEATAYFAAQSPFTRTVLVGDLNIAPLEHDVWSHKQLL
NVVSHTPPETTRMRQWLETGFVDAIRHFVPSDRKHYTWWSYRNRDWRASDRGRRLDHVWV
SPDLVSSLQGHTTLKEARDWERTSDHVPVSVTLSL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcactcatgcgtgtgcgtgttgcgacctggaacatcaattccctgcgtctgcgtctg
cccttgctggagaaagtgctggccgagcttgatccggatgtgctgtgccttcaggaaacc
aaggtgcctgaccccttgttcccggcagatctgttccccggcagggcggcggagcatcac
ggttatgcccatgtcgcctatcgcgggatgaaaggatataacggggttgccattctttcc
cggattcctttcacggtggatgaggcggcgccggactggtgcgccaaaggcgactgccgt
catatggcggtgtcgctggcagtgccgtcaggtcccgtggcgctgcataatttctatgtc
ccggcaggcggggatgagcccgacccggctatcaacccgaaattcgcgcataagttggct
ttcgtggaggaagccacggcctatttcgcggcgcagtctccttttacccgcaccgtgctg
gtcggtgacctcaatattgctccgctggagcatgatgtctggagccacaagcagctgctg
aatgtggtcagccatacgccgccggagaccacccggatgagacaatggctggaaaccggc
ttcgttgatgcaatacgccatttcgtgccgtcggaccgcaagcattatacgtggtggtca
taccggaaccgggactggcgtgcgtctgatcgggggcggaggctggaccatgtgtgggtc
agccctgatctggtttcttcactgcaaggccatacaaccttgaaagaggcccgagattgg
gagcgtacttctgatcatgtacccgtcagcgtgactttgtcgctgtaa

DBGET integrated database retrieval system